Details for Arabidopsis Locus AT3G03680

Position : Chr3 ( 5`- 907500 .. 910807 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03680

Protein [Map View]
MADNVLRKLIVEICSARNLMPKDGQGTASAYAIVDFDGQRRRTKTKFRDLNPQWDEKLEFFVHDVATMGEEILEINLCND
KKTGKRSTFLGKVKIAGSAFASAGSETLVYYPLEKRSVFSQIKGEIGLKAYYVDENPPAAPAATEPKPEAAAATEEKPPE
IAKAEDGKKETEAAKTEEKKEGDKKEEEKPKEEAKPDEKKPDAPPDTKAKKPDTAVAPPPPPAEVKNPPIPQKAETVKQN
ELGIKPENVNRQDLIGSDLELPSLTRDQNRGGGYDLVDRMPFLYIRVAKAKRAKNDGSNPVYAKLVIGTNGVKTRSQTGK
DWDQVFAFEKESLNSTSLEVSVWSEEKIEKEDKTTTTTESCLGTVSFDLQEVPKRVPPDSPLAPQWYTLESEKSPGNDVM
LAVWLGTQADEAFQEAWQSDSGGLIPETRSKVYLSPKLWYLRLTVIQTQDLQLGLGSEAKSKIPTTELYVKAQLGPQVFK
TARTSIGPSASSSGSGNPTWNEDLVFVASEPFEPFLIVTVEDITNGQSIGQTKIHMGSVERRNDDRTEPKSRWFNLAGDE
KKPYSGRIHVKVCLEGGYHVLDEAAHVTSDVRPSAKQLAKPPIGLLEVGIRGATNLLPVKTRDGTRGTTDAYVVAKYGPK
WIRTRTILDRFNPRWNEQYTWDVYDPCTVLTIGVFDNGRYKRDESGKQGRDVRVGKIRVRLSTLDMNRIYLNSYTLTVIL
PSGAKKMGEVEIAVRFSCPSWLSIIQAYVTPMLPRMHYVRPLGPAQQDILRHTAMRIVTARLARSEPPLGQEVVQYMLDT
DNHVWSMRRSKANWFRVITFLSRAATIARWIHGIRTWVHPPTTVLVHLLLVAIVLCPHLVLPTVFMYAFLILALRFRYRG
RVKVNSVDPRLSCVDSVAPDELDEEFDGFPTTRQPEVVRIRYDRLRALAGRAQTLLGDVAAQGERVEALFNWRDPRATCI
FVVFCLFASFLFYIVPFKVFLLGSGFYYIRHPRFRDDMPSVPVNFFRRLPSMSDQIL*

DNA
ATGGCAGACAATGTTCTGAGGAAGCTGATTGTTGAGATCTGTAGCGCAAGAAATCTGATGCCTAAGGATGGTCAAGGCAC
CGCGAGCGCTTACGCAATCGTGGATTTCGACGGCCAACGGCGACGGACGAAGACGAAATTCCGAGATCTGAATCCACAGT
GGGACGAGAAGCTCGAGTTCTTTGTGCACGACGTGGCGACTATGGGGGAAGAGATTCTTGAGATCAATCTTTGCAACGAT
AAGAAGACGGGAAAACGGAGCACGTTTCTCGGGAAAGTTAAGATCGCCGGAAGTGCGTTTGCGTCGGCTGGATCTGAAAC
TCTTGTTTATTATCCGCTTGAGAAGAGGAGCGTTTTCTCTCAGATCAAAGGTGAGATTGGATTAAAGGCTTATTACGTCG
ATGAGAATCCCCCGGCGGCGCCTGCTGCGACGGAGCCGAAACCTGAGGCTGCAGCTGCGACGGAAGAGAAGCCGCCGGAG
ATTGCAAAAGCAGAGGATGGGAAGAAAGAAACAGAGGCGGCGAAAACAGAGGAGAAGAAGGAAGGAGATAAAAAAGAAGA
GGAGAAACCGAAGGAAGAAGCTAAACCGGACGAGAAAAAACCCGATGCACCACCGGATACGAAGGCAAAGAAGCCTGATA
CCGCCGTAGCTCCTCCTCCTCCTCCGGCTGAGGTTAAGAATCCGCCTATACCGCAGAAGGCAGAGACTGTGAAGCAGAAT
GAATTAGGAATTAAACCGGAGAACGTAAACCGGCAAGATCTAATCGGGTCTGATCTCGAGCTTCCTTCACTAACCAGAGA
TCAGAATCGTGGTGGTGGTTACGATCTCGTCGATCGAATGCCGTTTCTATACATTCGTGTAGCTAAAGCGAAGCGAGCGA
AGAACGATGGAAGCAATCCGGTTTACGCGAAGCTCGTGATCGGAACAAATGGCGTGAAAACCAGAAGCCAAACCGGTAAA
GATTGGGATCAAGTGTTTGCTTTTGAGAAAGAGAGCTTAAACTCGACCTCGCTTGAAGTTTCCGTTTGGAGTGAAGAGAA
GATTGAGAAGGAAGATAAAACAACGACGACTACTGAGAGTTGTTTAGGAACGGTGTCGTTTGATCTTCAAGAGGTTCCTA
AGAGAGTGCCTCCGGATAGTCCTTTGGCTCCTCAATGGTACACATTGGAATCTGAGAAATCACCGGGGAATGACGTCATG
CTCGCTGTTTGGCTCGGGACTCAAGCTGATGAAGCGTTTCAAGAAGCTTGGCAATCTGATTCCGGTGGGTTGATTCCGGA
GACGAGATCCAAAGTTTACTTATCTCCGAAGCTTTGGTATTTGCGTCTAACGGTCATACAAACCCAAGATTTGCAGCTAG
GTTTGGGATCCGAAGCTAAGTCAAAGATCCCCACCACTGAGCTTTATGTGAAAGCTCAGCTTGGACCTCAAGTTTTCAAA
ACGGCTAGGACTTCGATTGGGCCGTCGGCTTCTTCGTCCGGATCCGGTAACCCGACTTGGAACGAGGATCTAGTTTTCGT
AGCTTCCGAGCCGTTTGAGCCGTTCTTGATAGTGACTGTGGAAGATATAACCAACGGGCAATCAATTGGTCAGACTAAGA
TACATATGGGAAGTGTTGAGAGGAGAAATGATGACCGGACTGAACCGAAATCGAGGTGGTTTAATCTCGCCGGCGATGAG
AAGAAACCGTACTCCGGGAGAATCCACGTGAAAGTTTGTCTTGAAGGTGGGTATCACGTGCTAGACGAAGCAGCTCACGT
GACGAGTGATGTCAGACCCTCTGCTAAACAGTTAGCCAAGCCACCTATTGGTTTATTGGAAGTGGGTATCCGTGGAGCTA
CTAATTTACTTCCTGTGAAAACCAGAGACGGTACACGTGGCACCACCGATGCTTATGTGGTTGCTAAATATGGACCGAAA
TGGATTCGGACTCGTACGATCCTAGACAGGTTTAATCCGCGGTGGAACGAGCAGTACACATGGGATGTTTATGATCCGTG
CACGGTCCTTACTATTGGAGTTTTCGACAATGGAAGATACAAACGGGACGAATCCGGAAAGCAAGGGAGAGATGTTAGGG
TCGGGAAAATCCGTGTACGTCTCTCGACACTCGACATGAACCGCATATACCTTAATTCCTACACCTTAACCGTGATCTTA
CCAAGCGGAGCCAAGAAAATGGGAGAAGTTGAAATCGCGGTTCGATTCTCTTGTCCATCTTGGCTAAGCATTATTCAAGC
CTATGTCACACCAATGCTACCTAGGATGCACTATGTCCGTCCGCTTGGTCCAGCTCAACAAGACATTTTGCGTCACACGG
CTATGCGTATCGTGACAGCCCGGCTTGCGCGGTCTGAGCCTCCATTAGGTCAAGAGGTGGTTCAGTACATGCTAGACACA
GACAATCATGTGTGGAGCATGAGGAGAAGCAAAGCTAATTGGTTCCGTGTCATCACGTTCTTGTCACGGGCCGCAACTAT
AGCCCGTTGGATTCACGGGATTCGAACTTGGGTTCACCCACCAACAACCGTTCTCGTTCACTTGCTTCTCGTGGCCATCG
TCTTGTGTCCACATTTAGTCCTCCCAACCGTATTCATGTACGCGTTCTTGATCTTAGCCTTACGATTCCGTTACCGTGGC
AGAGTCAAAGTCAACAGCGTTGACCCACGACTATCTTGCGTTGACTCCGTTGCTCCCGACGAGCTTGATGAAGAGTTTGA
TGGTTTCCCAACAACGAGACAACCGGAGGTCGTACGTATAAGGTATGACCGGTTAAGGGCATTGGCCGGTCGGGCACAGA
CTTTATTAGGTGACGTGGCGGCTCAAGGGGAGCGTGTTGAGGCGTTGTTCAACTGGAGAGACCCACGCGCCACGTGTATA
TTCGTAGTGTTCTGTCTTTTCGCGTCGTTTTTGTTCTACATCGTTCCGTTTAAAGTTTTCCTTTTGGGATCTGGTTTTTA
CTACATTCGACATCCGAGGTTTAGAGACGATATGCCTTCCGTTCCGGTCAACTTTTTCCGGCGACTTCCTTCAATGTCGG
ACCAGATTCTGTGA