Details for Arabidopsis Locus AT3G03670

Position : Chr3 ( 5`- 901841 .. 903411 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03670

Protein [Map View]
MKIATFSVLLLLLFIFPVALAQLKFKFYSESCPNAETIVENLVRQQFARDPSITAALTRMHFHDCFVQGCDASLLIDPTT
SQLSEKNAGPNFSVRGFELIDEIKTALEAQCPSTVSCSDIVTLATRDAVFLGGGPSYVVPTGRRDGFVSNPEDANEILPP
PFISVEGMLSFFGNKGMNVFDSVALLGAHTVGIASCGNFVDRVTNFQGTGLPDPSMDPTLAGRLRNTCAVPGGFAALDQS
MPVTPVSFDNLFFGQIRERKGILLIDQLIASDPATSGVVLQYASNNELFKRQFAIAMVKMGAVDVLTGSAGEIRTNCRAF
N*

DNA
ATGAAGATTGCAACGTTTTCTGTTCTACTCTTGCTTTTATTTATTTTCCCCGTGGCATTAGCGCAGCTGAAATTTAAGTT
TTACAGTGAATCGTGCCCTAATGCAGAGACTATCGTAGAAAACCTGGTTCGCCAGCAGTTTGCTCGTGACCCTTCAATCA
CGGCCGCCTTGACTCGTATGCATTTTCACGACTGTTTTGTCCAGGGCTGCGACGCTTCTCTCCTCATAGACCCAACGACG
TCTCAACTATCGGAAAAAAACGCCGGCCCAAACTTTAGCGTGAGAGGGTTCGAGCTGATCGACGAGATCAAGACGGCACT
CGAAGCTCAATGTCCCTCTACGGTCTCGTGCTCCGATATAGTCACGCTCGCCACACGTGACGCCGTGTTCTTAGGTGGAG
GACCAAGCTACGTGGTCCCCACCGGACGTCGCGATGGCTTTGTGTCGAATCCTGAAGACGCCAATGAGATCCTCCCTCCA
CCATTCATATCCGTCGAAGGCATGTTAAGTTTTTTCGGCAACAAAGGAATGAATGTTTTTGATTCCGTAGCTCTTTTGGG
GGCGCACACGGTTGGGATCGCGTCTTGTGGTAATTTTGTGGACCGGGTCACGAACTTTCAAGGAACCGGACTGCCCGACC
CATCCATGGACCCCACTTTGGCTGGCAGGCTAAGGAACACATGTGCGGTTCCAGGCGGCTTCGCGGCACTGGACCAGTCG
ATGCCAGTAACGCCGGTCTCATTCGACAACTTGTTCTTTGGTCAGATCAGAGAGAGGAAAGGAATTTTGCTTATTGACCA
ACTGATCGCAAGCGACCCGGCCACTTCTGGTGTTGTACTTCAGTACGCGTCCAACAACGAACTATTCAAACGTCAGTTCG
CAATCGCAATGGTGAAGATGGGAGCCGTTGACGTGCTTACCGGTTCAGCTGGTGAGATCAGGACGAATTGTAGAGCATTC
AACTAA