Details for Arabidopsis Locus AT3G03660

Position : Chr3 ( 5`- 889509 .. 892162 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03660

Protein [Map View]
MDQEQTPHSPTRHSRSPPSSASGSTSAEPVRSRWSPKPEQILILESIFHSGMVNPPKEETVRIRKMLEKFGAVGDANVFY
WFQNRRSRSRRRQRQLQAAAAAADATTNTCDQTMMVSNSLPHHSGSDLGFGGCSTSSNYLFGGSSQVPSFFLGLSSSPSS
CSSSSSTSSSASSSSSYGGGCDNQSNSGMENLLTMSGQMSYHEATHHHYQNHSSNVTSILCPSDQNSNFQYQQGAITVFI
NGVPTEVTRGGIDMKATFGEDLVLVHSSGVPLPTDEFGFLMHSLQHGEAYFLVPRQT*

DNA
ATGGACCAAGAACAAACACCACATAGCCCAACCCGCCATAGTCGCTCACCCCCATCCTCCGCCTCCGGTTCCACCTCAGC
AGAACCGGTTCGGTCCCGATGGTCACCTAAACCGGAACAAATACTCATACTTGAGTCGATCTTCCACAGTGGTATGGTTA
ACCCTCCCAAAGAAGAGACGGTAAGGATAAGAAAGATGCTCGAGAAATTTGGCGCGGTGGGAGATGCAAATGTCTTCTAT
TGGTTTCAAAACCGGCGGTCAAGGTCCCGTCGGAGACAGCGACAGCTACAGGCTGCAGCTGCAGCAGCGGACGCAACCAC
CAACACTTGTGACCAGACTATGATGGTGAGCAACAGCTTACCACATCATAGTGGGAGTGATTTGGGGTTTGGAGGTTGTA
GCACTTCTTCTAATTACTTATTTGGTGGGTCATCTCAAGTTCCTTCCTTTTTTCTTGGTCTCTCTTCTTCTCCTTCTTCT
TGTTCAAGCTCCTCTTCCACTTCTTCTTCAGCTAGCTCTTCTTCTTCTTATGGTGGTGGATGTGATAATCAAAGCAATAG
TGGCATGGAGAATCTCTTAACAATGTCTGGCCAAATGAGTTACCATGAAGCTACTCATCATCATTATCAAAATCATAGCT
CAAATGTCACATCGATTTTGTGCCCATCTGATCAAAACTCCAATTTTCAATACCAACAAGGGGCTATAACGGTGTTTATA
AACGGAGTTCCGACAGAAGTGACGAGAGGAGGAATAGACATGAAAGCAACGTTTGGAGAAGATTTGGTTTTGGTGCATTC
CTCAGGTGTTCCTCTTCCTACTGATGAGTTTGGTTTTTTGATGCATAGCTTACAACATGGTGAAGCTTATTTCCTGGTTC
CAAGACAGACATGA