Details for Arabidopsis Locus AT3G03650

Position : Chr3 ( 5`- 884133 .. 886410 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03650

Protein [Map View]
MGEKTNSRYLGVIITRKSIIFLFISIITVLSWFFIFSSTNPNRVLDHISVSESTDVPLIIIKNSNSSPQNNAPKPQNREG
AETEEPIKENRGGTKTESSMNQNRGETLRCIQRVSPSPRPLKVYMYDMSPEFHFGLLGWKPERNGVVWPDIRVNVPHHPG
GLNLQHSVEYWLTLDLLFSELPEDSRSSRAAIRVKNSSEADVVFVPFFSSLSYNRFSKVNQKQKKSQDKELQENVVKYVT
SQKEWKTSGGKDHVIMAHHPNSMSTARHKLFPAMFVVADFGRYSPHVANVDKDIVAPYKHLVPSYVNDTSGFDGRPILLY
FQGAIYRKAGGFVRQELYNLLKEEKDVHFSFGSVRNHGISKAGEGMRSSKFCLNIAGDTPSSNRLFDAIASHCIPVIISD
DIELPYEDVLNYNEFCLFVRSSDALKKGFLMGLVRSIGREEYNKMWLRLKEVERYFDLRFPVKDDEGDYAVQMIWKAVAR
KAPLVKMKVHRFQRFTRPF*

DNA
ATGGGTGAGAAAACAAACTCACGTTATCTCGGTGTAATCATCACTCGAAAATCTATAATTTTCTTGTTCATATCAATCAT
CACCGTCCTTTCTTGGTTTTTTATCTTTTCTTCCACAAACCCTAACCGAGTTCTCGATCACATCTCAGTATCAGAATCCA
CAGATGTACCTCTCATCATCATCAAGAACTCAAACAGTTCTCCACAAAACAACGCACCAAAACCCCAAAACAGAGAAGGA
GCAGAAACAGAGGAACCCATTAAAGAAAACAGAGGAGGAACAAAAACAGAGTCATCCATGAATCAAAACAGAGGCGAAAC
CCTCCGGTGTATCCAAAGGGTTTCTCCTTCTCCAAGGCCATTGAAAGTCTACATGTATGATATGAGTCCAGAGTTTCATT
TTGGGTTATTGGGTTGGAAACCAGAGAGAAACGGTGTCGTTTGGCCTGATATCAGAGTCAATGTTCCTCACCATCCAGGT
GGTCTTAACTTGCAGCACAGTGTTGAGTATTGGCTCACATTAGATCTTTTGTTCTCTGAGCTTCCAGAAGATTCTAGAAG
CTCTCGGGCCGCGATACGTGTAAAGAACTCGAGCGAAGCTGATGTCGTGTTCGTGCCCTTCTTCTCTTCATTGAGCTATA
ACCGATTCTCTAAGGTTAACCAAAAGCAGAAGAAGAGCCAGGACAAAGAGTTGCAGGAAAATGTGGTGAAATACGTAACG
TCCCAAAAAGAGTGGAAGACCTCAGGAGGGAAGGATCATGTGATCATGGCGCATCATCCGAATAGTATGTCGACGGCAAG
GCATAAGCTATTTCCGGCGATGTTTGTGGTCGCTGACTTTGGTAGATACTCGCCACATGTTGCCAATGTTGACAAAGACA
TTGTGGCTCCATACAAACACCTTGTTCCATCGTATGTTAATGACACATCGGGCTTTGATGGCCGTCCGATCTTGCTCTAC
TTCCAAGGAGCCATCTACCGCAAAGCTGGTGGATTTGTGAGACAAGAGCTATATAATCTTCTCAAAGAAGAAAAAGACGT
CCACTTCTCTTTCGGAAGCGTAAGGAACCACGGCATATCTAAAGCCGGCGAAGGAATGAGATCGTCCAAGTTCTGTCTCA
ACATAGCCGGGGATACACCATCCTCGAATCGCCTCTTCGACGCCATAGCTAGTCACTGTATACCCGTGATCATTAGCGAT
GACATCGAGTTACCATATGAGGATGTCCTCAACTACAATGAGTTCTGTCTCTTTGTCAGATCATCAGACGCTTTAAAGAA
AGGGTTTCTGATGGGTCTTGTCAGGAGTATTGGCAGAGAAGAGTATAATAAGATGTGGCTTCGGTTGAAGGAAGTGGAGA
GGTATTTCGATTTGCGTTTTCCGGTGAAGGATGACGAGGGAGATTATGCAGTTCAGATGATTTGGAAAGCTGTTGCCAGG
AAAGCTCCTTTGGTGAAGATGAAGGTTCACAGATTTCAGAGGTTTACAAGGCCTTTTTAG