Details for Arabidopsis Locus AT3G03620

Position : Chr3 ( 5`- 873749 .. 876800 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03620

Protein [Map View]
MSTQEEMEERLLREGSDAEGQSNNRESIYLRTKVWSEVNKMWRIALPSSLFRMTSFGSIIVAQAFIGHSSELGLAAYALL
QSTFIRFLYGLMGGMSSATETLCGQAYGAEQYHTMGIYLQRSWIVDMAVTTLFLPFIVLAGPILRLLGQNVEITKTVDEI
YPWMIPYVYSLIFTMTIQMYLQAQMRNAIVGVLSTLSLALDLVVTWWCVSVMGMGIGGALLGLNVGSWAMVLAEFVYIFG
GWCPFTWTGFSIAAFVDLIPMLKLSISSGFMICLEYWYMSILVLMAGYTKDAKIAISAFSICQYIYTWELNICLGFLGAA
CVRVANELGKGDAHAVRFSIKVILTISTLMGVIFSALCLAFCGRISYLFSNSDEVSDAVNDLSVILAVSILLNSIQPILS
GVAVGAGMQSIVAVVNLASYYAIGIPLGLILTYVFHLGVKGLWSGMLAGIAIQTIILCYIIYKTDWELEVKRTCERMKVW
SLKPSNEESNPIIREESRSK*

DNA
ATGAGTACTCAAGAAGAAATGGAGGAGAGGCTATTACGTGAAGGATCAGATGCTGAGGGTCAGAGCAATAATAGGGAGAG
TATCTATTTGAGAACGAAGGTCTGGAGTGAAGTAAATAAAATGTGGAGAATAGCATTACCTTCTTCTTTGTTCCGAATGA
CTTCGTTTGGGAGCATCATTGTGGCTCAAGCCTTCATTGGTCACTCCTCTGAGTTGGGTCTAGCCGCTTACGCACTCCTC
CAAAGCACATTCATCCGCTTCCTCTACGGTTTAATGGGCGGTATGTCAAGTGCAACGGAGACATTATGCGGGCAAGCATA
CGGTGCGGAACAATATCACACAATGGGGATATATCTACAACGTTCATGGATCGTGGACATGGCCGTGACCACTTTGTTTC
TACCGTTTATTGTACTTGCGGGTCCCATTCTCCGTCTATTAGGCCAAAACGTGGAGATCACAAAGACCGTTGATGAGATA
TATCCTTGGATGATTCCGTATGTATATAGCTTAATTTTCACTATGACTATACAAATGTACCTCCAAGCACAGATGAGGAA
CGCTATTGTAGGCGTTCTTTCGACATTGTCCTTGGCTCTTGACCTCGTGGTCACATGGTGGTGCGTGAGTGTTATGGGTA
TGGGCATTGGTGGTGCTCTCCTCGGACTTAATGTGGGCTCTTGGGCAATGGTATTAGCCGAGTTTGTGTACATTTTTGGT
GGATGGTGTCCTTTTACTTGGACCGGATTTAGTATTGCTGCTTTTGTTGACCTAATTCCTATGCTCAAGCTTTCCATTTC
TTCAGGCTTCATGATCTGCTTAGAGTATTGGTACATGAGCATCCTTGTCTTAATGGCGGGGTATACAAAAGATGCGAAAA
TCGCAATCTCTGCTTTCTCAATATGCCAATACATATATACATGGGAACTCAACATATGCCTTGGCTTCTTGGGTGCGGCA
TGCGTCCGGGTGGCTAACGAGTTGGGGAAAGGAGATGCACATGCAGTGAGATTTTCAATAAAAGTGATACTCACAATATC
AACATTGATGGGAGTGATATTCTCAGCTCTATGCTTAGCTTTTTGTGGTCGAATTTCCTATTTGTTTTCGAATAGCGACG
AGGTTTCGGATGCAGTGAATGATTTATCGGTGATCCTTGCTGTTTCAATCTTACTCAACAGCATACAACCTATACTCTCA
GGTGTAGCAGTTGGGGCAGGGATGCAGAGTATAGTGGCAGTTGTGAACTTAGCCTCTTATTATGCAATTGGTATTCCTTT
GGGTCTCATCCTTACTTATGTTTTCCATCTTGGTGTTAAGGGACTATGGTCTGGAATGTTGGCTGGAATTGCGATCCAAA
CAATAATATTATGTTATATAATTTACAAAACTGACTGGGAATTAGAGGTTAAAAGGACATGTGAACGTATGAAAGTGTGG
AGCCTGAAGCCATCTAATGAAGAGTCGAATCCCATAATAAGAGAAGAAAGTAGGAGCAAGTGA