Details for Arabidopsis Locus AT3G03610

Position : Chr3 ( 5`- 868791 .. 871812 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03610

Protein [Map View]
MASATLRRRLHHGDVDGRKYERYDATDSETLSEPLLGSSSTDNSRNEYIEERTLEDIWEEERKRQQVHWTLIFSQLIAQW
AQWIAKIVFGSGSLVGRFLSLPTFGQIGTGGRLLPPPLSMLQEERLRNIKRRIEIPFDGSRMEHQDALRQLWRLAYPQRE
LPPLKSELWKEMGWQGTDPSTDFRGGGYISLENLIFFAKTYPESFQRLLHKQDGTRAEWEYPFAVAGINISFMLAQMLDL
QSGKPSTIAGIRFLGFLEEDEMAFDNLYCIAFQMMDAQWLARRASYMEFNDVLKSTRAQLERELALDDVSSITDLPAFNL
LYK*

DNA
ATGGCATCTGCGACTCTGAGAAGGCGGCTTCATCACGGTGATGTAGATGGGAGGAAGTATGAACGCTATGATGCAACAGA
CTCTGAAACTTTAAGTGAACCCTTGTTAGGAAGTAGTAGTACTGATAATAGTAGAAATGAGTACATTGAGGAGCGTACTC
TGGAGGATATTTGGGAAGAAGAACGGAAGAGACAGCAAGTTCACTGGACGTTAATCTTTTCTCAGTTGATTGCACAGTGG
GCTCAGTGGATAGCCAAAATAGTCTTTGGATCTGGCTCACTTGTTGGGAGGTTTCTTTCTCTGCCTACATTTGGTCAAAT
AGGTACTGGTGGGAGGCTTCTGCCACCACCTCTTAGTATGTTGCAGGAAGAAAGGCTGAGAAATATTAAGCGAAGAATAG
AAATCCCATTTGATGGATCTCGAATGGAGCATCAAGATGCTCTTAGACAACTATGGAGGCTAGCTTATCCACAGAGAGAA
CTACCACCTCTTAAATCTGAACTCTGGAAGGAAATGGGTTGGCAAGGAACAGACCCTTCAACAGATTTTCGAGGTGGAGG
GTATATATCACTGGAGAATCTAATCTTCTTTGCGAAGACCTATCCGGAATCATTCCAGAGATTGTTACATAAACAAGATG
GAACTAGAGCGGAATGGGAATATCCTTTCGCGGTGGCTGGCATCAATATCTCATTCATGCTGGCACAAATGTTAGATCTT
CAATCAGGTAAACCATCAACAATAGCCGGGATAAGATTCTTGGGATTTCTGGAAGAAGACGAAATGGCATTCGATAATCT
CTACTGTATAGCTTTCCAAATGATGGATGCACAATGGCTTGCTAGACGAGCTTCTTACATGGAATTCAATGACGTCCTGA
AATCGACGAGAGCACAATTGGAACGTGAGCTGGCACTGGATGATGTTTCAAGCATCACAGACTTGCCTGCTTTCAATCTT
TTGTACAAATAA