Details for Arabidopsis Locus AT3G03580

Position : Chr3 ( 5`- 860512 .. 863352 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03580

Protein [Map View]
MQTRVSSPFISRALSSSSNLNELRRIHALVISLGLDSSDFFSGKLIDKYSHFREPASSLSVFRRVSPAKNVYLWNSIIRA
FSKNGLFPEALEFYGKLRESKVSPDKYTFPSVIKACAGLFDAEMGDLVYEQILDMGFESDLFVGNALVDMYSRMGLLTRA
RQVFDEMPVRDLVSWNSLISGYSSHGYYEEALEIYHELKNSWIVPDSFTVSSVLPAFGNLLVVKQGQGLHGFALKSGVNS
VVVVNNGLVAMYLKFRRPTDARRVFDEMDVRDSVSYNTMICGYLKLEMVEESVRMFLENLDQFKPDLLTVSSVLRACGHL
RDLSLAKYIYNYMLKAGFVLESTVRNILIDVYAKCGDMITARDVFNSMECKDTVSWNSIISGYIQSGDLMEAMKLFKMMM
IMEEQADHITYLMLISVSTRLADLKFGKGLHSNGIKSGICIDLSVSNALIDMYAKCGEVGDSLKIFSSMGTGDTVTWNTV
ISACVRFGDFATGLQVTTQMRKSEVVPDMATFLVTLPMCASLAAKRLGKEIHCCLLRFGYESELQIGNALIEMYSKCGCL
ENSSRVFERMSRRDVVTWTGMIYAYGMYGEGEKALETFADMEKSGIVPDSVVFIAIIYACSHSGLVDEGLACFEKMKTHY
KIDPMIEHYACVVDLLSRSQKISKAEEFIQAMPIKPDASIWASVLRACRTSGDMETAERVSRRIIELNPDDPGYSILASN
AYAALRKWDKVSLIRKSLKDKHITKNPGYSWIEVGKNVHVFSSGDDSAPQSEAIYKSLEILYSLMAKEGYIPDPREVSQN
LEEEEEKRRLICGHSERLAIAFGLLNTEPGTPLQVMKNLRVCGDCHEVTKLISKIVGREILVRDANRFHLFKDGTCSCKD
RW*

DNA
ATGCAGACTAGAGTGTCATCACCTTTCATCTCTAGAGCTCTTTCGTCGTCATCTAACCTCAATGAGCTTCGTCGAATTCA
CGCCCTTGTGATCTCTCTTGGTCTTGACAGCTCCGACTTCTTCTCCGGTAAGCTTATCGACAAGTACTCTCACTTTCGTG
AACCCGCCTCTTCCCTCTCTGTTTTCCGACGAGTTTCTCCGGCCAAAAATGTTTACCTCTGGAATTCAATCATCAGAGCT
TTTTCTAAGAATGGTTTGTTCCCTGAAGCCCTCGAGTTTTACGGGAAACTCCGGGAATCCAAGGTTTCTCCTGATAAGTA
CACGTTTCCTTCGGTTATCAAAGCCTGCGCGGGATTGTTCGATGCGGAGATGGGAGATTTGGTTTATGAACAGATATTGG
ATATGGGTTTTGAATCGGATTTATTTGTAGGTAATGCACTTGTGGATATGTATTCGAGAATGGGATTGTTAACTAGAGCA
CGACAAGTGTTCGACGAAATGCCTGTGAGAGATCTCGTGTCCTGGAACAGTTTGATTTCTGGGTATAGTTCCCATGGTTA
CTATGAGGAAGCTTTGGAAATTTATCATGAGTTGAAGAATTCGTGGATTGTACCAGATTCCTTCACGGTTTCAAGTGTTT
TGCCTGCATTTGGGAATTTGCTGGTTGTCAAACAAGGACAGGGACTTCATGGTTTTGCTCTGAAGTCAGGTGTTAATTCC
GTTGTGGTGGTTAACAATGGACTAGTTGCAATGTACTTGAAATTTCGCAGACCAACGGATGCAAGACGAGTTTTTGATGA
GATGGATGTTCGAGATTCTGTTAGTTACAATACTATGATCTGCGGATATCTCAAGTTAGAGATGGTTGAAGAATCCGTGA
GGATGTTTTTGGAAAACTTGGATCAGTTCAAGCCTGATCTCTTAACAGTTAGTTCTGTTCTCCGTGCCTGCGGACACTTA
CGGGACTTGAGCTTGGCAAAGTACATTTACAACTATATGTTGAAAGCTGGATTTGTTCTTGAATCTACTGTTAGAAACAT
TCTAATTGACGTGTATGCAAAGTGTGGTGACATGATCACCGCAAGAGATGTTTTCAACAGCATGGAATGCAAGGATACTG
TTTCGTGGAACTCGATAATCAGTGGATATATACAAAGCGGAGATCTTATGGAAGCCATGAAACTCTTCAAGATGATGATG
ATCATGGAAGAGCAGGCGGATCACATCACTTATTTGATGCTTATATCTGTCTCCACACGTCTAGCAGACTTGAAATTTGG
GAAAGGGCTACACTCAAATGGGATAAAATCTGGAATTTGTATCGATCTTTCTGTTAGTAATGCTTTGATTGATATGTATG
CGAAGTGCGGGGAAGTAGGAGATTCCTTGAAGATATTCAGTAGTATGGGAACTGGGGATACGGTAACATGGAACACGGTT
ATTTCAGCATGTGTTCGTTTTGGGGATTTCGCAACCGGTTTGCAGGTAACTACTCAAATGAGGAAGAGCGAAGTGGTGCC
TGATATGGCTACTTTCTTAGTTACATTGCCTATGTGTGCTTCACTTGCTGCAAAACGACTAGGCAAGGAGATCCATTGTT
GTCTGTTGAGGTTTGGATATGAATCAGAGTTGCAAATAGGGAATGCACTAATTGAAATGTACTCAAAATGTGGTTGTTTG
GAGAATTCGTCTAGAGTCTTTGAACGTATGAGTAGAAGAGATGTTGTGACATGGACAGGAATGATCTATGCATATGGAAT
GTATGGCGAAGGTGAGAAAGCTCTTGAAACTTTTGCGGATATGGAAAAATCCGGTATTGTTCCCGATAGTGTTGTCTTCA
TTGCCATCATATATGCTTGCAGCCACTCTGGTTTGGTAGACGAAGGCTTGGCTTGCTTTGAGAAGATGAAAACTCACTAC
AAAATTGACCCGATGATTGAACATTATGCTTGTGTGGTCGATTTGCTGTCCCGGTCACAGAAGATTTCAAAAGCCGAAGA
ATTTATCCAAGCAATGCCGATAAAACCAGATGCAAGCATATGGGCATCTGTGCTAAGAGCTTGTCGAACAAGTGGGGACA
TGGAGACTGCTGAAAGAGTATCTAGGAGGATCATTGAACTGAACCCGGATGATCCAGGTTACTCGATTCTAGCATCAAAC
GCATATGCAGCCTTGAGAAAATGGGACAAAGTGAGTCTAATCCGCAAATCCTTGAAAGATAAACACATCACGAAGAATCC
TGGATATAGCTGGATCGAAGTCGGTAAAAACGTTCACGTGTTCAGCTCAGGAGATGATTCAGCTCCTCAGTCAGAAGCCA
TCTACAAGTCACTGGAGATACTTTACAGTCTGATGGCTAAAGAAGGCTACATTCCCGATCCAAGGGAAGTGTCACAGAAT
CTAGAGGAAGAAGAAGAGAAGAGACGTTTAATCTGTGGGCACAGCGAGAGACTTGCTATTGCGTTTGGACTGTTGAACAC
AGAACCAGGGACTCCATTGCAGGTGATGAAGAACCTTCGTGTTTGTGGTGACTGTCATGAAGTCACGAAGCTGATATCGA
AGATTGTGGGACGTGAGATATTAGTGCGGGATGCTAATCGATTCCATCTCTTCAAAGACGGCACTTGTAGCTGCAAAGAT
CGGTGGTGA