Details for Arabidopsis Locus AT3G03550

Position : Chr3 ( 5`- 850108 .. 851590 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03550

Protein [Map View]
MGSTGNPNPWGTTYDSYRDCSQGVCSVYCPQWCYVIFPPPPSFYLDDEDDSSSSDFSPLLIALIGILASAFILVSYYTLI
SKYCHRRRHNSSSTSAAAINRISSDYTWQGTNNNNNNGATNPNQTIGGGGGDGLDESLIKSITVYKYRKMDGFVESSDCS
VCLSEFQENESLRLLPKCNHAFHVPCIDTWLKSHSNCPLCRAFIVTSSAVEIVDLTNQQIVTENNSISTGDDSVVVVNLD
LENSRSRNETVNEGSTPKPPEMQDSRDGEERRSASLNSGGGVVSIADILREIEDDEESAGVGTSRWVEEGEGEKTPPPSG
SAANQTNGISNFLVRSSMAAMKRSGYDRAKNYRLPK*

DNA
ATGGGTTCAACAGGAAACCCTAATCCATGGGGTACAACATACGATTCATACAGAGACTGTTCTCAAGGAGTATGCAGTGT
CTATTGCCCTCAATGGTGTTACGTCATCTTCCCTCCTCCTCCTTCCTTCTATCTCGACGACGAAGACGACTCTTCCTCCT
CTGATTTCTCTCCTCTCCTCATCGCTCTCATCGGAATCCTCGCTAGCGCCTTCATCCTCGTCAGCTACTACACTCTCATC
TCCAAATACTGCCACCGCCGTCGCCACAACTCCTCCTCTACCTCCGCCGCAGCTATAAACAGAATCTCATCAGATTACAC
CTGGCAAGGAACCAACAACAACAACAACAACGGAGCTACGAATCCGAATCAAACGATTGGTGGTGGTGGTGGCGATGGAC
TCGATGAATCTCTGATTAAATCGATAACTGTTTACAAATACAGAAAGATGGATGGATTTGTTGAATCTTCAGATTGCTCT
GTTTGTTTAAGCGAGTTTCAAGAGAACGAGAGCTTGAGATTGTTACCTAAATGCAACCACGCGTTTCACGTTCCTTGTAT
TGATACTTGGTTGAAATCTCACTCTAATTGTCCTCTCTGCCGCGCCTTCATCGTCACTTCCTCCGCCGTTGAGATCGTCG
ATTTAACCAATCAACAGATCGTTACGGAGAACAACTCGATTTCGACCGGAGATGATTCCGTCGTTGTCGTTAACTTAGAT
CTGGAAAATTCTAGATCTCGGAATGAGACGGTTAATGAAGGATCGACGCCGAAACCACCGGAGATGCAGGATTCAAGAGA
CGGAGAAGAGCGGAGATCGGCGTCGTTAAACTCAGGCGGCGGTGTGGTATCGATCGCAGATATACTAAGGGAGATTGAAG
ACGACGAAGAATCAGCGGGTGTAGGAACTTCTCGGTGGGTAGAAGAAGGGGAAGGAGAGAAGACGCCTCCGCCGTCAGGA
TCGGCGGCGAATCAAACAAACGGAATTTCGAATTTTCTGGTTCGGAGTTCAATGGCGGCGATGAAGAGATCTGGTTACGA
TAGAGCAAAAAATTACCGTTTACCGAAATAA