Details for Arabidopsis Locus AT3G03440

Position : Chr3 ( 5`- 815644 .. 818834 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03440

Protein [Map View]
MDLAGETNSLISTVASSSSCSSSVSSIDTSLDCDSPRGGDVDHELLHTAVSVSSSVSVSSSSSASIQRVLSLIRSEDCDS
RLFAAKEIRRLTKTSHRCRRHFSQAVEPLVSMLRFDSPESHHEAALLALLNLAVKDEKNKVSIIEAGALEPIINFLQSNS
PTLQEYASASLLTLSASANNKPIIGANGVVPLLVKVIKHGSPQAKADAVMALSNLSTLPDNLSMILATKPLSPILNLLKS
SKKSSKTSEKCCSLIEALMVSGEEARTGLVSDEGGVLAVVEVLENGSLQAREHAVGVLLTLCQSDRSKYREPILREGVIP
GLLELTVQGTSKSRIKAQRLLCLLRNSESPRSEVQPDTIENIVSSLISHIDGDDQSGKAKKMLAEMVQVSMEKSLRHLQE
RASTLVRP*

DNA
ATGGACCTCGCCGGAGAAACAAACAGCCTTATCTCCACCGTCGCTTCTTCTTCTTCCTGTTCTTCCTCCGTGTCGTCAAT
CGACACAAGCCTCGATTGCGATTCGCCACGTGGCGGAGATGTAGACCACGAATTGCTCCACACGGCGGTTTCGGTTTCTT
CGTCGGTGTCGGTTTCTTCGTCTTCTTCTGCTTCAATCCAGAGAGTTCTGAGCTTAATCCGATCGGAGGATTGCGATTCG
AGGCTGTTTGCTGCTAAAGAGATCCGTCGGCTGACAAAGACGTCTCATAGGTGCCGCCGACACTTTTCCCAAGCCGTGGA
ACCTCTCGTTTCTATGCTCCGATTTGATTCGCCTGAATCTCACCACGAGGCTGCTTTACTCGCTCTCCTTAACCTCGCCG
TCAAAGACGAAAAGAATAAAGTGAGTATAATTGAAGCCGGTGCTTTAGAGCCAATCATCAACTTCTTACAATCAAATAGC
CCAACACTTCAAGAGTATGCTTCTGCATCTTTGCTCACTCTCTCCGCGTCAGCAAACAACAAACCCATCATTGGAGCTAA
TGGTGTGGTTCCTTTATTAGTCAAGGTCATTAAACATGGAAGCCCACAAGCTAAAGCTGATGCAGTAATGGCTCTTTCCA
ACCTCTCTACACTCCCCGATAACCTAAGCATGATCCTAGCAACTAAACCACTCTCACCAATACTGAATCTTCTCAAATCA
AGTAAAAAGTCGTCGAAAACATCTGAGAAATGTTGTTCACTAATAGAGGCCTTGATGGTTTCTGGTGAGGAGGCGAGAAC
AGGGTTAGTTTCTGATGAAGGAGGAGTTTTAGCGGTCGTGGAAGTTCTTGAAAACGGGTCATTACAAGCTCGGGAACATG
CCGTTGGCGTGCTTTTAACGCTCTGCCAAAGCGATAGGAGTAAATACAGAGAGCCAATTCTTAGAGAAGGTGTAATACCG
GGACTGCTTGAGCTCACGGTTCAGGGGACATCGAAATCTCGGATTAAAGCTCAAAGACTTCTCTGTTTACTAAGGAACTC
GGAAAGTCCGAGATCAGAGGTCCAACCCGATACAATAGAAAACATAGTGTCAAGCTTAATCTCTCATATAGACGGAGATG
ATCAATCCGGTAAGGCAAAGAAGATGCTAGCTGAAATGGTCCAAGTTAGCATGGAAAAAAGCTTGAGACATCTACAAGAA
CGTGCCTCGACTCTTGTTCGTCCATAA