Details for Arabidopsis Locus AT3G03370

Position : Chr3 ( 5`- 797254 .. 799148 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03370

Protein [Map View]
MVDEDHLEDFVCYTEPLDDNIEVLVPDDDHGLYAIDILDPSWKVANEDISGLGDLVSVLSKLSRGARVPLEYMSHTDRHR
KKHLNNLPFRFKKNRDFDFFSHLFLRDRLGGAFHENIASLAAWSVSSMLRTLMDSTYKFVVAQLHTFSSLSLDSFCGISP
ERLLCERSTFSRFPKLCGINPEMSLYERPCFEFFQFTAKLCITIVKLYMKRKSEDELTRDSFMPVSQEMKGEIHQDCSQR
DPRP*

DNA
ATGGTTGATGAGGATCACTTAGAAGATTTTGTCTGTTATACAGAGCCGTTGGATGATAATATTGAAGTATTGGTCCCTGA
TGATGACCATGGACTCTATGCAATTGACATTCTAGATCCCTCTTGGAAGGTTGCTAATGAGGACATTTCCGGTCTTGGAG
ATTTAGTATCTGTTCTTTCAAAGCTTTCTAGGGGTGCTCGTGTTCCATTGGAATATATGTCTCACACTGATCGTCATCGC
AAGAAGCATCTGAATAATCTTCCATTTCGTTTTAAAAAAAACAGAGATTTTGATTTCTTCAGTCATCTGTTCTTGAGAGA
TCGCCTTGGTGGTGCTTTCCATGAAAACATTGCTTCTCTGGCTGCTTGGTCTGTGTCGAGCATGCTGAGGACTCTCATGG
ATTCTACCTATAAGTTTGTTGTTGCTCAACTCCATACATTCAGCTCACTGAGCTTGGATAGTTTCTGCGGGATTTCGCCT
GAGAGGTTATTGTGTGAAAGGTCTACCTTCTCAAGATTTCCAAAACTTTGTGGGATCAATCCAGAGATGTCGTTGTATGA
GAGACCTTGCTTTGAATTCTTCCAGTTCACTGCTAAGTTATGTATTACGATAGTGAAGCTGTATATGAAACGCAAAAGCG
AAGATGAACTTACGAGAGATTCTTTCATGCCTGTATCCCAGGAGATGAAGGGAGAGATCCATCAAGATTGTTCTCAGAGA
GATCCAAGACCTTGA