Details for Arabidopsis Locus AT3G03341

Position : Chr3 ( 5`- 790130 .. 790648 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03341

Protein [Map View]
MIPICVQCGTGGNPCRCKVVGPTLGLVAFVAAGIVEWPVGALVYIFKHAKGRRIMGHPATHVYPKVSRSIPI*

DNA
ATGATTCCGATATGCGTGCAGTGCGGAACGGGCGGAAACCCTTGTAGATGCAAAGTGGTAGGACCGACGTTAGGGCTTGT
GGCGTTTGTAGCAGCCGGAATAGTTGAATGGCCGGTCGGAGCATTGGTTTATATCTTTAAGCACGCCAAAGGTCGCCGCA
TTATGGGTCATCCGGCCACCCATGTTTATCCCAAGGTCTCTCGTTCCATTCCCATATGA