Details for Arabidopsis Locus AT3G03340

Position : Chr3 ( 5`- 786320 .. 790077 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03340

Protein [Map View]
MDAIRKQLDVLMGANRNGDVQEVNRKYYDRDVCRLYLSGLCPHDLFQLTKMDMGPCPKVHSLQLRKEYREARAKGVDNYD
RELEDAIDRLIVECDRKIGRALKRLQEEDAKAAIAISVSEVTQSPEILELSEKIKEKMKEADIHDLEGKMDLKIRALELV
EEMRTKRADQQAVLLLEAFNKDRASLPQPVPAQPPSSELPPPDPRTQEMINEKLKKAEDLGEQGMVDEAQKALEEAEALK
KLTVRREPPADSTKYTAVDVRITDQKLRLCDICGAFLSVYDSDRRLADHFGGKLHLGYMLVRDKLTELLDEKANIRKERS
KERNSKERESSKDREKEQETSREHRRDYDRRSRDRDRHHDRDREQDRDYDRSHSRSRRRSRSRSRSRDRPRDYDRHRRHN
RY*

DNA
ATGGACGCTATAAGGAAGCAGCTTGATGTGCTCATGGGAGCTAACCGAAACGGCGACGTTCAGGAGGTGAATCGCAAATA
CTACGACCGTGATGTGTGTCGTCTTTACTTGTCTGGTCTCTGCCCTCACGATCTCTTCCAATTGACGAAAATGGATATGG
GACCATGCCCAAAGGTGCACTCTTTGCAGCTTCGGAAAGAATACCGAGAAGCAAGGGCAAAAGGTGTTGATAACTACGAC
AGGGAATTGGAAGATGCCATAGACAGGCTTATCGTTGAGTGTGATAGGAAGATTGGTAGGGCCCTTAAGCGTCTTCAAGA
AGAGGACGCCAAAGCTGCCATTGCCATTTCTGTCTCTGAAGTCACTCAGTCGCCTGAAATTCTCGAGTTATCGGAGAAAA
TCAAAGAGAAGATGAAGGAAGCAGATATCCACGATCTTGAAGGCAAAATGGATCTTAAGATTAGAGCTCTTGAGTTAGTC
GAAGAGATGAGGACCAAGAGAGCTGACCAACAGGCGGTGTTGCTGTTGGAAGCCTTCAACAAAGATAGAGCATCCTTGCC
ACAGCCCGTTCCAGCTCAACCACCATCTTCCGAATTACCTCCACCGGATCCTCGCACTCAAGAAATGATAAATGAGAAAC
TGAAGAAGGCAGAAGATCTTGGTGAACAAGGAATGGTTGATGAAGCCCAGAAAGCCCTGGAAGAGGCTGAAGCTCTTAAG
AAGCTTACAGTTAGACGAGAACCTCCAGCAGATTCAACGAAGTACACCGCTGTTGATGTGCGCATCACAGACCAAAAGTT
GCGTCTATGTGACATATGTGGAGCATTCTTGAGCGTCTATGACAGTGATCGCCGTTTAGCTGATCATTTTGGGGGGAAGC
TTCATCTAGGATACATGCTAGTCCGGGACAAATTAACAGAGCTTCTGGATGAGAAGGCCAATATACGCAAGGAAAGATCA
AAGGAACGGAACAGTAAGGAGAGAGAATCAAGTAAAGACCGAGAGAAAGAACAAGAAACTAGTCGTGAACATCGAAGAGA
TTATGATCGCAGGAGTAGAGATCGAGATAGGCACCATGACCGTGATCGTGAACAAGACAGAGACTATGATCGGTCACACT
CAAGAAGCAGACGTAGGTCACGCTCACGGTCCAGGTCAAGAGATAGACCAAGGGACTATGATCGCCACAGGCGTCACAAC
CGCTACTAG