Details for Arabidopsis Locus AT3G03330

Position : Chr3 ( 5`- 783332 .. 786209 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03330

Protein [Map View]
MLTLLFFSLGALLLIVLLFKFAFADGDFTLISKKHVKREAIQGKVVWITGASRGIGEILAKQFASLDAKLILSARNKAEL
DRVKSELKGKFAPEDVKVLPLDLASGEESLKHVVEQAVSLFPGAGVDYLVHNAAFERPKSKASDASEETLKTTFDVNVFG
TISLTKLVAPHMLKQGGGHFVVISSAAGKVPSPGQAIYSASKHALHGYFHSLRSEFCQKGIKVTVVCPGPIETWNGTGTS
TSEDSKSPEKRVSSERCAELTIIAASHNLKEAWISYQPVLLVMYLVQYMPSLGFWLMDKVGGKRVEVAEKKGNTYSWDLL
FGKKTKTN*

DNA
ATGCTGACTCTACTCTTCTTCTCTCTCGGAGCGCTTCTTCTTATCGTTCTGCTCTTCAAATTTGCATTCGCCGATGGAGA
TTTTACCTTGATTTCGAAGAAGCATGTGAAGCGTGAGGCCATACAAGGCAAGGTCGTCTGGATCACAGGGGCTAGCCGTG
GAATTGGTGAAATTCTTGCTAAACAGTTTGCAAGTTTAGATGCCAAGCTTATTCTCTCTGCTAGGAATAAAGCTGAACTG
GATCGGGTTAAGAGTGAGCTTAAAGGTAAATTTGCACCAGAAGATGTCAAGGTTTTGCCTTTAGATTTAGCTAGCGGCGA
AGAGTCACTCAAACATGTTGTAGAGCAAGCAGTGTCGCTTTTCCCTGGAGCTGGTGTTGATTATTTGGTTCACAATGCTG
CCTTTGAGCGTCCGAAATCCAAGGCATCGGATGCAAGTGAGGAAACTCTCAAGACTACATTCGATGTTAATGTCTTTGGG
ACGATATCTCTGACAAAGTTGGTAGCTCCTCATATGCTAAAACAAGGAGGGGGTCATTTTGTTGTGATAAGCAGTGCTGC
AGGAAAGGTACCATCACCTGGACAGGCTATATATTCTGCTTCAAAACATGCTCTTCATGGCTACTTCCACAGCTTGCGTT
CTGAGTTCTGTCAGAAGGGAATCAAGGTTACCGTCGTTTGTCCTGGTCCAATAGAAACCTGGAATGGTACAGGAACATCA
ACTTCGGAAGACAGCAAGTCTCCTGAGAAACGTGTGTCATCTGAACGATGTGCAGAGCTGACTATAATCGCTGCATCTCA
TAACTTGAAGGAAGCTTGGATTTCATATCAGCCAGTACTACTCGTGATGTATCTAGTGCAGTACATGCCTTCCCTTGGCT
TCTGGCTCATGGACAAGGTTGGAGGAAAGCGTGTGGAGGTCGCGGAAAAGAAAGGCAACACATACTCGTGGGATTTACTG
TTCGGGAAGAAGACTAAAACAAACTGA