Details for Arabidopsis Locus AT3G03320

Position : Chr3 ( 5`- 781715 .. 783464 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03320

Protein [Map View]
MEQPMSPGTKSVDLRECMESLLRFSLRSHLNESVPSFDLDLTRDFCLHLLGEATDSTEKSAVYKLLATALSECLASEGDK
NSNLEKYSKLIHGLGYDLINMLKEVNFELHVQEPYFTQLKDGLKTVEGRCAVGDYMRISSGDFLLFNKCLLLEVQDVHRY
TSFSEMLKVEGLAKVLPGVESIEEGVQVYRNFYSEEKERMNGVVAIRVAKPANQPSAALAGVLSELKSSGIKSLLDEYTA
GVTS*

DNA
ATGGAGCAACCAATGTCGCCGGGAACGAAGTCGGTGGATCTCCGAGAATGCATGGAATCACTTCTCCGTTTTAGTCTGAG
ATCTCATTTAAACGAATCTGTTCCAAGTTTCGATCTTGACCTGACCAGAGATTTTTGTCTTCATCTCCTTGGGGAAGCTA
CAGATTCAACAGAAAAATCTGCGGTGTACAAGCTTCTAGCAACGGCTTTGTCTGAATGTCTAGCTTCCGAGGGTGATAAA
AATTCTAACTTGGAAAAATACAGCAAACTGATTCATGGCTTGGGATATGACTTAATAAATATGTTGAAGGAGGTGAACTT
TGAGCTTCATGTCCAAGAGCCTTACTTCACCCAATTGAAAGATGGTTTGAAAACTGTTGAAGGAAGATGCGCAGTGGGAG
ACTACATGAGAATTAGTTCAGGAGATTTTCTTTTGTTCAATAAATGCTTGCTGCTTGAAGTTCAGGACGTTCACCGTTAT
ACTTCATTCTCAGAAATGCTGAAAGTGGAGGGTCTTGCCAAAGTTCTTCCTGGAGTTGAAAGTATAGAAGAAGGTGTTCA
AGTTTACCGAAACTTTTATTCTGAAGAGAAGGAAAGAATGAACGGTGTTGTAGCTATTCGTGTTGCAAAACCAGCTAATC
AGCCTTCTGCAGCTTTGGCAGGAGTATTGTCTGAACTGAAGTCCAGTGGGATCAAAAGCCTGTTGGATGAATACACAGCT
GGGGTTACCTCGTAG