Details for Arabidopsis Locus AT3G03305

Position : Chr3 ( 5`- 775368 .. 778396 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03305

Protein [Map View]
MESIGDDDELRSKTVSLPRRISFTILLLLLLISLSTRVSGSLDKSGRRVIEARTGQDLIWVVQLSDLHFSVHHPERAIDF
KNIVGPALALINPSLVLITGDLTDGKSKDMLTMKLNEDEWLEYESVMQDVVKRSGLNKSIFYDLRGNHDNFGVPSVGSSV
DFFSKYSINGQMGRKGNVNTITVETSERKHLFVGIDTTMHIGLRGPTNLFGHPTDELLSSLDSHLSQWDNQSAKPVAKIS
FGHFPLSFTALSHSQKSLKDVFLKHSISAYLCGHLHSRFGKNLKRHHHSGGISLSDNDLFQLNMRQSGAESTSNCSFGAL
PAAEFWEWEMGDWRKNRAMRIMAIDRGHVSYVDLDFKSKPQKTIILPTFPLDSRFMSTSFARHKYECQHMISSSYDAIRA
IVFSHSLVVEVVARVYDSSPGFDNLVMEAPMRKHGGDSSSSGATFFSLPWNYRAFEDPLPDRFWLQIEVTDIKGRLTLSE
MRPFSINGLSSKVSWTWNEFRVMGCQWAALYYPILWPALYSLFLVFLIPKCIIIVFKKQYTLKKFIAKKGPITLVLWILQ
DLCRMPVVWFGYMAYLFYLIFFPWFSGEVFADSGDRAYMTIMGWVVTSSGADRKHEYIGQPDVMVVVIPHVVFVVIPSVL
VVCCLVAEREIYKDHIRTVSGKKEDDHDRGRKKRSQRRSLLFSNRRLFRKSVLLASLALYWKHFKNCWALGRAYEMNVVH
FPGYSLVVPLLLLYVICKTHKVP*

DNA
ATGGAATCGATCGGCGACGACGATGAGCTCCGAAGCAAAACAGTTTCTCTTCCGAGAAGAATCTCGTTTACGATTCTTCT
TCTTCTTCTGTTAATCTCCTTGAGTACAAGGGTCTCTGGTTCGTTAGACAAATCTGGAAGAAGAGTGATTGAAGCGAGAA
CTGGGCAAGACTTGATTTGGGTTGTTCAGCTATCCGATCTCCATTTCAGTGTCCATCATCCTGAAAGAGCCATTGATTTC
AAAAACATTGTGGGTCCTGCTCTGGCTCTTATCAACCCTTCTCTCGTCTTAATCACCGGTGATCTCACAGATGGGAAAAG
CAAAGACATGTTAACAATGAAGTTAAATGAAGATGAGTGGTTAGAATACGAGAGTGTGATGCAAGATGTTGTGAAGAGAA
GTGGGCTTAATAAGAGCATATTTTATGATCTTAGGGGTAACCATGACAACTTTGGTGTTCCGTCTGTTGGTTCATCTGTT
GATTTCTTCTCAAAGTATAGCATCAATGGACAGATGGGAAGGAAAGGAAATGTTAACACCATAACTGTTGAGACTAGCGA
ACGTAAACATCTGTTTGTCGGTATTGACACCACAATGCATATTGGATTACGCGGCCCAACAAATCTCTTTGGGCATCCAA
CTGATGAACTTTTGAGCTCACTCGACTCACACCTCTCGCAATGGGATAACCAATCAGCAAAACCTGTTGCAAAAATATCA
TTTGGGCATTTCCCATTGTCATTCACAGCGCTGTCACATTCTCAAAAGAGCCTTAAAGATGTTTTTCTGAAGCACTCTAT
CTCAGCTTATTTGTGTGGCCATCTACACTCAAGGTTCGGCAAGAATCTTAAAAGACATCATCACTCTGGTGGTATCAGTT
TATCAGATAATGACTTGTTTCAGCTGAATATGAGGCAGAGTGGTGCTGAAAGTACTTCGAACTGCTCTTTTGGAGCCTTA
CCAGCTGCAGAGTTCTGGGAATGGGAGATGGGTGACTGGAGAAAAAACAGGGCAATGCGGATCATGGCCATTGATAGGGG
TCATGTTTCATATGTTGATCTTGACTTCAAGTCAAAACCCCAGAAGACTATCATATTACCGACCTTTCCATTAGATTCAC
GTTTTATGTCAACATCCTTTGCACGTCACAAATACGAGTGCCAACATATGATCTCATCATCGTATGACGCAATAAGAGCC
ATTGTTTTTTCTCATTCTCTGGTTGTGGAAGTTGTAGCTAGAGTTTATGACTCAAGCCCTGGATTTGATAATCTGGTCAT
GGAAGCTCCAATGAGAAAACATGGAGGCGATTCTTCTTCTTCCGGGGCAACATTCTTTTCACTTCCATGGAATTATAGGG
CCTTTGAAGATCCCTTACCTGATAGATTTTGGCTGCAAATAGAAGTCACTGATATCAAAGGCAGATTAACCTTATCAGAA
ATGCGACCATTTTCCATCAATGGTCTAAGCTCTAAAGTTTCATGGACATGGAATGAGTTCCGTGTCATGGGCTGCCAGTG
GGCGGCATTATATTACCCGATTCTTTGGCCTGCTCTATATAGTTTGTTTCTCGTTTTTCTTATCCCCAAATGCATCATCA
TCGTTTTCAAGAAGCAGTACACTCTCAAGAAGTTCATTGCCAAGAAAGGACCTATCACACTTGTACTGTGGATTCTCCAA
GACCTCTGCAGAATGCCTGTGGTTTGGTTCGGTTACATGGCATACTTGTTCTATCTCATATTCTTTCCTTGGTTCTCCGG
TGAAGTGTTTGCTGATTCTGGAGACAGAGCATACATGACTATTATGGGATGGGTGGTGACGAGCTCAGGCGCAGATAGGA
AACATGAATACATTGGACAACCTGATGTAATGGTTGTGGTGATCCCACATGTGGTCTTTGTTGTTATCCCCAGTGTCTTG
GTTGTGTGTTGTCTGGTTGCTGAGAGAGAAATCTACAAAGATCACATTCGAACTGTCTCTGGTAAGAAAGAGGATGACCA
TGACCGGGGAAGGAAGAAGAGATCACAACGCCGCTCACTGTTATTCTCGAACAGAAGACTGTTTCGGAAATCGGTCTTGC
TGGCTTCATTAGCTCTATATTGGAAGCATTTCAAGAATTGCTGGGCATTAGGTAGAGCTTATGAGATGAATGTGGTTCAT
TTTCCAGGTTACAGCCTTGTAGTTCCATTGTTGCTACTATATGTTATCTGCAAAACCCATAAAGTTCCATGA