Details for Arabidopsis Locus AT3G03280

Position : Chr3 ( 5`- 765459 .. 766387 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03280

Protein [Map View]
MGNYVSCALNKTSSSPLAKVILPDGGVRDIHVPTKAAELMMEMPSYFLVDTKSVKVGRKFIPLAADDDLDLGGCHVYVAF
PMTRATSAANASDMARLYLTGKKRTKNCGHRRVSPENEDNDDVRLIGPKLNLEDIEEFSAAEFIHRISVSKSKKPQLETI
AEDHVP*

DNA
ATGGGCAACTACGTTTCATGCGCTCTAAACAAAACGTCATCGTCACCGTTGGCAAAAGTGATTCTCCCTGACGGTGGAGT
GCGTGACATCCACGTGCCGACGAAAGCAGCCGAGCTCATGATGGAGATGCCAAGCTATTTCCTCGTCGACACCAAGTCGG
TGAAAGTAGGCCGTAAATTTATCCCACTCGCCGCCGACGACGATCTTGATCTTGGAGGCTGTCATGTGTACGTCGCATTT
CCGATGACACGTGCCACTTCTGCAGCCAACGCTTCCGACATGGCTAGGCTCTACCTCACCGGAAAGAAACGCACGAAAAA
CTGCGGTCATAGGAGAGTGTCTCCGGAAAATGAAGATAATGATGACGTGAGGCTGATCGGACCGAAGCTGAATCTTGAAG
ACATAGAAGAGTTCTCGGCGGCAGAGTTTATTCATCGGATCTCTGTTTCGAAATCTAAGAAACCACAGTTGGAGACGATA
GCTGAAGATCATGTGCCCTAA