Details for Arabidopsis Locus AT3G03230

Position : Chr3 ( 5`- 744389 .. 746009 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03230

Protein [Map View]
MVLLLVIVGLISYYVYKSITPPPPIPLPENVSEISPRIKLNDGRHLAYKELGFPKDKAKNKIIIVHGNGNSKDVDLYITQ
EMIDEFKIYFLFFDRAGYGESDPNPTRTLKTDTYDIEELADKLQVGPKFHVIGMSLGAYPVYGCLKYIPNRLSGASLVVP
LVNFWWSRVPQNLLNAAMKKLPIGFQLTLRVAHYSPWLLYWWMTQKWFPNSRNPKDTMTERDLELAEKHTKHSYIKESAL
RQGGYVTTQQDIIAGYGNWEFDPTELKNPFSDSNKGSVHMWCALEDKQISRDVLLYICDKLPWIKLHEVPDGGHYIIHEK
RHFEAIIKAACSD*

DNA
ATGGTGCTTCTACTTGTGATTGTGGGATTAATAAGCTATTATGTCTACAAGTCCATAACACCGCCGCCACCGATTCCACT
GCCGGAAAATGTTTCCGAGATATCTCCAAGAATCAAGCTCAATGATGGAAGGCATTTAGCGTACAAGGAATTAGGGTTTC
CAAAGGACAAAGCCAAAAACAAAATAATAATCGTCCACGGAAATGGAAATTCCAAAGACGTCGATTTATACATCACACAG
GAAATGATTGATGAATTCAAGATATACTTTTTGTTCTTCGATAGAGCTGGTTATGGAGAAAGCGATCCTAATCCAACACG
AACGCTGAAAACAGATACATACGATATCGAAGAACTTGCTGACAAATTGCAAGTCGGTCCAAAGTTCCACGTTATAGGCA
TGTCACTTGGAGCTTACCCTGTTTACGGTTGCCTCAAATACATTCCTAATAGGCTCAGTGGAGCTTCGTTGGTTGTTCCG
TTAGTGAATTTTTGGTGGAGCCGTGTGCCTCAAAACTTATTGAATGCAGCGATGAAGAAATTGCCAATTGGATTTCAATT
GACACTTCGAGTCGCACACTACTCTCCATGGTTGTTATATTGGTGGATGACTCAGAAATGGTTCCCGAATAGTCGAAATC
CCAAAGATACTATGACCGAGCGCGACCTAGAACTCGCGGAAAAGCATACCAAACACTCTTATATCAAGGAGTCTGCTTTA
CGACAAGGTGGATATGTGACCACACAACAAGACATCATAGCGGGTTACGGGAATTGGGAATTTGATCCAACCGAATTGAA
GAATCCGTTTTCGGATAGTAACAAAGGGTCGGTTCATATGTGGTGTGCACTCGAAGACAAACAAATTTCACGCGATGTTT
TACTCTATATATGCGATAAACTGCCATGGATAAAGCTCCATGAGGTCCCTGATGGTGGACATTATATTATCCATGAGAAG
CGGCATTTTGAAGCCATTATCAAAGCCGCTTGTAGTGACTAG