Details for Arabidopsis Locus AT3G03200

Position : Chr3 ( 5`- 736141 .. 738527 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03200

Protein [Map View]
MAPVSLPPGFRFHPTDEELITYYLKRKINGLEIELEVIAEVDLYKCEPWDLPGKSLLPSKDQEWYFFSPRDRKYPNGSRT
NRATKGGYWKATGKDRRVSWRDRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRLDETECEPSAYGMQDAYALCRVFKKIVI
EAKPRDQHRSYVHAMSNVSGNCSSSFDTCSDLEISSTTHQVQNTFQPRFGNERFNSNAISNEDWSQYYGSSYRPFPTPYK
VNTEIECSMLQHNIYLPPLRVENSAFSDSDFFTSMTHNNDHGVFDDFTFAASNSNHNNSVGDQVIHVGNYDEQLITSNRH
MNQTGYIKEQKIRSSLDNTDEDPGFHGNNTNDNIDIDDFLSFDIYNEDNVNQIEDNEDVNTNETLDSSGFEVVEEETRFN
NQMLISTYQTTKILYHQVVPCHTLKVHVNPISHNVEERTLFIEEDKDSWLQRAEKITKTKLTLFSLMAQQYYKCLAIFF*

DNA
ATGGCTCCTGTCTCGTTACCTCCAGGTTTCCGATTCCATCCAACAGACGAGGAACTAATTACTTACTATCTAAAAAGAAA
GATCAACGGTCTAGAAATCGAACTTGAAGTTATCGCTGAAGTTGATCTTTACAAGTGTGAGCCATGGGACTTACCAGGGA
AGTCCTTGCTTCCGAGCAAAGACCAAGAATGGTACTTCTTCAGCCCACGAGACCGGAAGTATCCCAACGGCTCAAGGACA
AACCGGGCAACTAAAGGCGGTTATTGGAAGGCTACAGGTAAAGACCGCCGAGTTAGTTGGAGAGACCGAGCCATAGGAAC
CAAGAAGACATTGGTTTACTACCGTGGGCGCGCGCCACATGGCATAAGAACTGGTTGGGTCATGCACGAATATCGACTTG
ATGAAACAGAATGTGAGCCTTCTGCATACGGCATGCAGGACGCATATGCACTTTGTCGTGTGTTCAAAAAGATTGTTATT
GAAGCTAAGCCAAGAGATCAACATCGGTCATATGTCCACGCGATGTCGAATGTGAGTGGTAATTGCTCATCGAGTTTTGA
CACTTGTTCGGATCTCGAAATCAGTTCAACTACTCATCAAGTTCAAAACACATTCCAACCGCGATTTGGCAACGAGCGAT
TTAACTCCAACGCAATCAGCAACGAGGATTGGTCACAATACTACGGTTCTTCTTATAGACCGTTCCCTACTCCATATAAG
GTTAACACAGAGATCGAATGTTCAATGTTACAACACAATATATATCTACCACCGTTGCGTGTAGAGAACTCTGCGTTTAG
TGATTCCGATTTCTTCACGAGTATGACTCACAACAACGACCATGGCGTTTTCGATGACTTTACTTTTGCTGCAAGTAACT
CCAACCACAATAATAGCGTTGGTGATCAAGTGATCCACGTTGGCAATTATGATGAACAATTAATAACATCTAACCGTCAT
ATGAACCAGACTGGTTATATAAAAGAGCAGAAGATCAGATCGAGTTTGGATAATACTGACGAAGATCCAGGATTTCATGG
TAACAATACCAATGACAACATAGATATCGATGATTTTCTCTCGTTTGATATATATAACGAGGACAACGTGAATCAAATAG
AAGATAATGAAGACGTGAATACAAATGAAACCCTTGATTCATCGGGATTCGAGGTGGTTGAAGAAGAAACTAGATTTAAC
AACCAAATGCTCATCTCGACATATCAAACGACAAAGATTCTATATCACCAAGTCGTACCTTGTCACACGTTGAAAGTTCA
CGTCAATCCTATTAGTCACAATGTGGAAGAGAGAACATTGTTCATTGAAGAGGACAAAGATTCTTGGTTACAAAGAGCTG
AGAAGATCACGAAGACAAAACTAACACTTTTTAGTTTAATGGCTCAGCAATACTACAAATGTCTTGCTATTTTTTTCTGA