Details for Arabidopsis Locus AT3G03190

Position : Chr3 ( 5`- 735028 .. 735987 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03190

Protein [Map View]
MVVKVYGQIKAANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYAD
QGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSGKPCDVALVEELKVKFDKVLDVYENRLATNRYLGGD
EFTLADLSHMPGMRYIMNETSLSGLVTSRENLNRWWNEISARPAWKKLMELAAY*

DNA
ATGGTGGTCAAAGTATATGGGCAGATAAAAGCAGCTAATCCACAAAGAGTATTGCTCTGCTTTTTGGAAAAAGACATCGA
GTTTGAAGTAATTCATGTCGATCTCGATAAACTTGAACAGAAAAAACCACAACATCTTCTTCGTCAGCCGTTTGGTCAAG
TTCCAGCTATTGAAGATGGATATCTGAAGCTTTTTGAATCGCGAGCCATAGCGAGGTACTACGCGACAAAGTATGCGGAC
CAAGGAACGGACCTATTGGGCAAGACTTTGGAGGGACGAGCCATTGTGGACCAGTGGGTGGAAGTTGAGAATAACTATTT
CTACGCTGTGGCTCTACCCTTAGTTATGAACGTCGTCTTTAAGCCCAAGTCTGGTAAGCCATGCGACGTCGCTTTGGTTG
AGGAGCTAAAGGTCAAGTTCGACAAGGTCCTGGATGTGTATGAGAACCGGTTAGCTACGAACCGGTACTTGGGCGGTGAT
GAATTCACATTAGCTGATTTGAGTCATATGCCCGGTATGAGATATATCATGAATGAAACCAGTTTGAGTGGTTTGGTTAC
GTCTCGAGAGAATCTCAACCGGTGGTGGAATGAGATTTCGGCTAGACCGGCTTGGAAGAAGCTCATGGAATTGGCTGCCT
ATTAA