Details for Arabidopsis Locus AT3G03170

Position : Chr3 ( 5`- 731891 .. 732875 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03170

Protein [Map View]
MHYQEQMESLMLGEERRRGNYTRDVDADADEGVNSPSSFPNSPDDSDRRSSSSSSRRGLSKHYKGKSQSFTTLAEALTVE
DLAKPENPFNAKLKQRRESPHCRRLSGCGGASERNLSVHDVFLAGNDRPPRLSGNRPPPRAQTLSAAHISALLTRT*

DNA
ATGCACTATCAAGAACAGATGGAGTCTCTTATGTTGGGTGAAGAACGCAGACGCGGAAACTACACCAGAGACGTAGACGC
GGACGCAGATGAAGGTGTTAACTCTCCCTCTTCTTTTCCAAACTCCCCTGATGATTCGGACCGTCGCAGTTCTTCTTCTT
CTTCAAGGAGAGGATTGTCGAAACATTACAAAGGTAAATCACAATCGTTCACAACGTTGGCAGAAGCGCTAACTGTGGAA
GATCTCGCGAAGCCTGAGAATCCATTCAACGCAAAGCTGAAGCAGCGACGAGAGAGCCCTCACTGTCGTAGATTATCAGG
ATGCGGCGGCGCATCGGAGCGAAATTTAAGTGTCCACGACGTTTTTCTCGCTGGGAACGATAGACCGCCGCGACTTTCCG
GTAACAGACCGCCTCCGAGAGCCCAGACGCTCTCGGCGGCTCATATTTCGGCTTTGCTCACTCGAACCTAA