Details for Arabidopsis Locus AT3G03110

Position : Chr3 ( 5`- 708936 .. 717093 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03110

Protein [Map View]
MAAEKLRDLSQPIDVVLLDATVEAFYSTGSKEERASADNILRDLKANPDTWLQVVHILQNTSSTHTKFFALQVLEGVIKY
RWNALPVEQRDGMKNYISDVIVQLSRDEASFRTERLYVNKLNIILVQIVKQEWPAKWKSFIPDLVIAAKTSETICENCMA
ILKLLSEEVFDFSKGEMTQQKIKELKQSLNSEFQLIHELCLYVLSASQRQELIRATLSALHAYLSWIPLGYIFESPLLEI
LLKFFPVPAYRNLTLQCLSEVASLNFGDFYDMQYVKMYSIFMNQLQAILPLNLNIPEAYSTGSSEEQAFIQNLALFFTSF
FKLHIKILESAPENISLLLAGLGYLISISYVDDTEVFKVCLDYWNSLVLELFGTRHHACHPALTPSLFGLQMAFLPSTVD
GVKSEVTERQKLYSDPMSKLRGLMISRTAKPEEVLIVEDENGNIVRETMKDNDVLVQYKIMRETLIYLSHLDHEDTEKQM
LSKLSKQLSGEEWAWNNLNTLCWAIGSISGSMVVEQENRFLVMVIRDLLSLCEVVKGKDNKAVIASNIMYVVGQYSRFLR
AHWKFLKTVVHKLFEFMHETHPGVQDMACDTFLKIVQKCKRKFVIVQVGESEPFVSELLSGLATIVGDLQPHQIHTFYES
VGSMIQAESDPQKRGEYLQRLMALPNQKWAEIIGQARQSADILKEPDVIRTVLNILQTNTRVATSLGTFFLSQISLIFLD
MLNVYRMYSELVSSSIANGGPYASRTSLVKLLRSVKREILKLIETFLDKAENQPHIGKQFVPPMMDQVLGDYARNVPDAR
ESEVLSLFATIINKYKVVMRDEVPLIFEAVFQCTLEMITKNFEDYPEHRLKFFSLLRAIATFCFRALIQLSSEQLKLVMD
SVIWAFRHTERNIAETGLNLLLEMLKNFQKSDFCNKFYQTYFLQIEQEVFAVLTDTFHKPGFKLHVLVLQHLFSLVESGS
LAEPLWDAATVPHPYSNNVAFVLEYTTKLLSSSFPNMTTTEVTQFVNGLYESRNDVGRFKDNIRDFLIQSKEFSAQDNKD
LYAEEAAAQMERERQRMLSIPGLIAPSEIQDDMADS*

DNA
ATGGCTGCCGAGAAGTTAAGAGACTTGAGTCAGCCGATTGACGTCGTTTTACTCGATGCCACTGTTGAGGCCTTTTACTC
TACCGGATCTAAGGAAGAAAGAGCTTCTGCGGATAATATCTTGCGGGATTTGAAAGCTAATCCTGATACTTGGCTTCAAG
TTGTTCACATTCTACAGAACACCAGTAGTACGCATACCAAATTTTTTGCCCTTCAGGTGCTGGAAGGTGTTATAAAATAT
AGGTGGAATGCATTACCCGTTGAACAACGTGATGGAATGAAAAATTACATCTCTGATGTCATTGTGCAGCTGTCAAGGGA
TGAAGCATCTTTCAGAACGGAAAGGCTTTATGTCAACAAGTTAAATATCATCCTGGTTCAGATCGTGAAACAGGAGTGGC
CGGCAAAGTGGAAAAGCTTTATTCCTGATTTAGTTATAGCTGCTAAGACTAGTGAAACTATCTGTGAGAATTGCATGGCT
ATTTTGAAACTCCTAAGTGAAGAGGTCTTTGATTTCTCAAAAGGAGAGATGACTCAGCAAAAGATAAAAGAACTGAAACA
GTCTCTAAACAGCGAGTTTCAACTCATTCACGAGTTATGCCTATATGTCCTCTCAGCTTCCCAAAGACAAGAGCTTATAC
GTGCTACACTCTCTGCATTGCATGCCTATCTTTCTTGGATTCCGTTGGGATACATATTTGAGTCCCCTTTGCTGGAGATC
CTACTTAAATTCTTCCCTGTTCCAGCATATAGGAATCTCACACTTCAATGTTTGTCAGAGGTTGCATCTCTTAATTTTGG
GGACTTCTACGATATGCAATATGTCAAGATGTACAGCATTTTCATGAATCAGTTGCAGGCAATTCTCCCTTTAAATTTAA
ATATCCCTGAGGCATATTCAACTGGAAGTAGTGAAGAACAGGCTTTTATCCAGAACTTGGCACTGTTTTTCACTTCGTTT
TTCAAGTTACATATAAAAATCCTAGAATCTGCACCCGAAAATATTTCTCTATTACTTGCGGGTCTGGGATATCTCATTAG
CATATCGTATGTTGATGACACTGAAGTATTCAAGGTTTGTTTGGACTATTGGAATTCATTAGTGTTGGAGTTGTTTGGGA
CGCGACATCATGCGTGTCACCCTGCACTAACTCCAAGTCTGTTTGGATTGCAAATGGCTTTCCTTCCTAGTACAGTTGAT
GGTGTTAAATCTGAAGTCACTGAGCGGCAAAAACTTTATTCAGATCCAATGTCAAAATTAAGGGGACTCATGATTAGTCG
CACGGCTAAGCCTGAAGAAGTGTTAATTGTTGAGGACGAAAATGGGAACATTGTTCGTGAAACTATGAAGGATAATGATG
TTCTTGTCCAGTATAAGATAATGCGGGAGACATTAATCTACCTCTCACACCTTGATCATGAAGATACCGAAAAACAGATG
TTGAGTAAGCTAAGCAAACAGTTGAGCGGGGAGGAATGGGCATGGAACAATCTAAACACTTTATGCTGGGCTATTGGGTC
TATTTCTGGGTCCATGGTAGTAGAACAGGAAAACAGATTTCTCGTGATGGTTATCCGTGATTTGTTAAGTTTATGTGAAG
TCGTCAAGGGAAAAGACAATAAAGCTGTTATTGCGAGCAACATCATGTACGTTGTTGGACAATATTCAAGATTCTTAAGA
GCCCATTGGAAGTTTTTGAAGACAGTTGTCCATAAGCTGTTTGAATTTATGCATGAGACGCATCCTGGTGTTCAGGACAT
GGCTTGCGACACATTCTTAAAAATTGTTCAGAAGTGTAAGCGAAAATTTGTTATTGTTCAGGTTGGAGAAAGTGAGCCAT
TTGTGTCTGAACTTCTATCAGGCCTTGCTACAATCGTCGGAGATCTTCAACCTCATCAGATTCATACATTTTATGAATCT
GTTGGTAGTATGATCCAGGCAGAATCAGATCCTCAGAAGAGGGGGGAATACCTCCAGAGGTTGATGGCTCTCCCGAATCA
GAAATGGGCAGAAATTATAGGACAAGCACGTCAAAGTGCAGATATCCTCAAGGAACCAGATGTGATACGTACTGTGCTTA
ATATCCTCCAGACAAATACGCGCGTTGCAACTTCACTAGGAACATTCTTCCTGTCTCAAATTTCGTTGATCTTCTTGGAT
ATGCTGAATGTTTACAGAATGTATAGTGAACTCGTTTCAAGCAGCATTGCTAATGGTGGCCCATACGCTTCGAGAACATC
TCTTGTTAAACTTTTAAGGTCTGTTAAGAGGGAAATTCTTAAGCTGATAGAGACGTTTTTAGATAAAGCTGAAAACCAGC
CACACATTGGAAAACAGTTTGTTCCACCAATGATGGATCAAGTACTTGGCGACTATGCAAGAAATGTTCCTGATGCAAGA
GAATCAGAAGTCTTGTCACTCTTTGCGACAATAATCAACAAATACAAGGTTGTAATGCGAGATGAAGTTCCCCTCATATT
TGAAGCTGTTTTCCAGTGCACATTGGAGATGATTACTAAGAATTTTGAAGATTACCCAGAGCACCGTCTCAAGTTTTTCT
CGTTACTTCGTGCTATTGCTACATTTTGTTTCCGTGCGTTGATACAGTTGTCAAGTGAGCAACTGAAGCTAGTGATGGAT
TCAGTTATCTGGGCATTTAGGCATACTGAAAGAAATATCGCTGAAACTGGGCTCAATCTCTTGCTCGAGATGCTGAAAAA
CTTTCAGAAATCTGACTTTTGTAACAAATTCTACCAAACATACTTTCTGCAAATTGAGCAAGAAGTATTTGCTGTCTTGA
CCGATACCTTCCACAAGCCTGGGTTCAAGTTGCATGTGTTGGTGTTGCAGCACTTATTTAGCCTGGTTGAGAGCGGATCA
TTGGCAGAACCATTGTGGGATGCTGCAACGGTACCGCATCCTTATTCAAATAATGTCGCCTTTGTGCTTGAGTACACCAC
CAAGCTTCTAAGCTCATCATTCCCCAACATGACTACAACAGAGGTGACACAGTTTGTGAATGGACTTTACGAGTCGAGAA
ACGATGTTGGCAGATTTAAGGATAACATACGCGACTTCCTTATACAGTCCAAGGAATTTTCTGCTCAGGATAACAAAGAT
TTATATGCTGAGGAAGCTGCTGCCCAAATGGAGAGAGAGAGACAAAGAATGCTTTCGATTCCTGGACTTATAGCTCCCAG
CGAAATTCAAGACGACATGGCCGATTCTTAA