Details for Arabidopsis Locus AT3G03090

Position : Chr3 ( 5`- 700456 .. 704769 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03090

Protein [Map View]
MGFDPENQSISSVGQVVGDSSSGGITAEKEPLLKENHSPENYSVLAAIPPFLFPALGALLFGYEIGATSCAIMSLKSPTL
SGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRKELILAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGIGL
TMHAAPMYIAETAPSQIRGRMISLKEFSTVLGMVGGYGIGSLWITVISGWRYMYATILPFPVIMGTGMCWLPASPRWLLL
RALQGQGNGENLQQAAIRSLCRLRGSVIADSAAEQVNEILAELSLVGEDKEATFGELFRGKCLKALTIAGGLVLFQQITG
QPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGVSVIVIDRVGRRPLLLCGVSGMVISLFLLGSYYMFYKNVPA
VAVAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSL
FFIYYIVPETKGLTLEEIEAKCL*

DNA
ATGGGGTTTGATCCCGAGAACCAATCGATCTCTTCCGTTGGACAGGTTGTTGGTGATTCTTCTTCAGGTGGGATTACTGC
TGAAAAGGAACCTTTGTTAAAGGAAAACCACAGCCCAGAGAACTACTCTGTTCTTGCAGCCATTCCTCCGTTTCTCTTTC
CAGCTCTTGGAGCATTGCTTTTTGGTTATGAAATTGGTGCAACATCTTGTGCTATCATGTCTCTTAAGTCGCCTACTCTA
AGTGGAATTTCATGGTACGACTTGTCTTCAGTGGATGTTGGTATAATTACCAGTGGCTCACTGTATGGTGCCTTAATTGG
CTCCATTGTTGCATTTAGTGTTGCCGACATTATAGGAAGGAGAAAGGAGCTGATTTTGGCTGCATTCTTGTATCTTGTTG
GAGCCATTGTGACTGTAGTAGCACCTGTCTTTTCCATACTGATAATTGGACGAGTTACGTATGGCATGGGGATTGGACTG
ACCATGCACGCGGCTCCAATGTACATTGCAGAGACTGCTCCAAGTCAAATACGTGGACGGATGATATCACTAAAGGAATT
CTCCACTGTCCTTGGGATGGTTGGGGGTTATGGAATCGGTAGCCTTTGGATTACGGTTATTTCTGGTTGGCGTTACATGT
ACGCAACAATTCTCCCTTTTCCAGTTATTATGGGAACTGGAATGTGTTGGCTACCAGCATCTCCGAGGTGGCTTTTACTG
CGCGCTCTCCAGGGACAAGGAAATGGGGAGAATCTTCAACAGGCTGCGATTAGATCTCTTTGTCGCCTTAGAGGGTCTGT
CATAGCTGACTCAGCAGCTGAACAAGTAAACGAAATATTGGCTGAACTTTCCCTTGTGGGTGAAGACAAAGAAGCTACAT
TTGGTGAATTATTTCGAGGCAAATGCTTGAAAGCTCTCACTATAGCAGGAGGGTTAGTCTTGTTCCAACAGATAACTGGG
CAACCAAGTGTACTATATTATGCACCATCAATACTACAGACTGCCGGCTTTTCTGCTGCAGCTGATGCAACTCGGATCTC
AATTCTGCTCGGCCTATTGAAGTTGGTTATGACAGGAGTTTCTGTGATAGTTATCGACAGAGTTGGAAGGAGACCTTTAC
TTCTTTGTGGTGTTAGCGGAATGGTGATCTCATTGTTCCTCCTGGGATCCTACTACATGTTTTATAAAAATGTACCAGCT
GTTGCTGTAGCTGCATTGCTACTGTATGTAGGCTGTTACCAGCTGTCCTTTGGCCCTATTGGTTGGCTGATGATTTCAGA
GATATTTCCCTTAAAATTAAGAGGTAGAGGAATCAGTCTAGCAGTGCTTGTGAATTTTGGCGCAAACGCACTTGTGACAT
TCGCTTTCTCACCGCTAAAGGAGCTGTTAGGAGCTGGAATACTGTTCTGTGCATTTGGAGTGATATGTGTCGTGTCTCTC
TTCTTCATATACTACATTGTGCCAGAGACAAAGGGTCTCACTCTTGAAGAAATTGAAGCCAAATGTCTCTAA