Details for Arabidopsis Locus AT3G03060

Position : Chr3 ( 5`- 692056 .. 695648 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03060

Protein [Map View]
MAQKCAIGLISALAASASLAKSKVASADGPFNLSGFSTSANPQQQASPPPPSLAGEESSAPPRARNDNPRTSSGGFDPEA
LERGAKALKEINHSSYAKKVFESIKQQEETKQTEFATKAQEFKAMQAQAETERHKVIYDEQKKLAQHQAQTKSQMARYED
DLARKRMQAENEFHRTRNQELVKMQEDSAIRQEQARRATEEQIQAQRRQTEREKAEIERETIRVKAIAEAEGRAHEARLA
EDVNRRMLVDRANAEREKWVAAINTTFDHIGGGLRAILTDQNKLIVAVGGVTALAAGIYTTREGAKVIWSYVDRILGQPS
LIRESSRGKYPWSGSLSRVMSTLRGKESASKNGKRFGDVILHPPLAKRIEHLATSTANTKLHQAPFRNILLHGPPGTGKT
MAARELARKSGLDYALMTGGDVAPLGAQAVTKIHELFDWGKKSKRGLLLFIDEADAFLCERNKTYMSEAQRSALNALLFR
TGDQSKDIVLALATNRPGDLDSAVADRVDEVLEFPLPGEEERFKLLNLYLEKYIAEAGPSKPGLFDRLFKKEQQKIEIKG
VTEELLKEAAAKTEGFSGREIAKLMASVQAAVYGSEDCVLDSMLFREVVDYKVAEHQQRRKLAGVDSK*

DNA
ATGGCTCAGAAATGTGCGATTGGTTTGATTTCAGCCCTAGCAGCTTCGGCTTCTCTTGCGAAATCTAAAGTCGCTTCTGC
AGATGGTCCCTTCAATCTCTCTGGGTTCTCTACTTCTGCGAATCCTCAGCAGCAGGCTTCTCCTCCTCCACCGTCGTTGG
CTGGTGAAGAATCTTCAGCTCCTCCGCGAGCTCGCAATGATAATCCGAGGACAAGTTCCGGTGGTTTCGATCCGGAGGCA
CTGGAGCGAGGTGCTAAAGCCTTGAAAGAGATTAACCATTCCTCTTACGCGAAAAAGGTTTTTGAAAGTATTAAGCAGCA
AGAAGAGACAAAGCAAACTGAGTTTGCAACGAAGGCGCAAGAGTTTAAAGCTATGCAAGCCCAAGCTGAAACTGAGAGGC
ATAAGGTAATATATGATGAACAGAAAAAGCTTGCTCAGCACCAAGCACAGACAAAATCGCAGATGGCCCGTTATGAAGAT
GACTTGGCAAGAAAGAGGATGCAGGCCGAGAATGAGTTCCATAGAACAAGAAATCAAGAACTTGTGAAAATGCAAGAAGA
TTCAGCAATTAGGCAGGAACAAGCTCGACGAGCTACTGAGGAACAGATCCAGGCGCAGAGACGCCAAACTGAGAGGGAGA
AGGCTGAGATTGAACGTGAGACCATCAGGGTCAAAGCTATAGCAGAAGCGGAAGGAAGAGCCCATGAAGCTAGGCTTGCT
GAAGATGTAAACAGGAGAATGCTTGTTGATCGTGCAAATGCAGAAAGAGAGAAATGGGTTGCTGCCATAAACACAACATT
CGACCATATTGGAGGCGGTTTACGTGCTATTCTGACGGATCAAAATAAACTGATTGTCGCTGTTGGGGGTGTAACTGCTC
TGGCAGCTGGAATCTACACAACGAGAGAAGGTGCAAAGGTTATCTGGAGCTATGTGGACAGAATATTAGGACAACCATCG
TTAATCCGAGAATCATCAAGAGGCAAGTACCCTTGGTCTGGTTCGCTTTCTCGTGTAATGTCCACATTGCGGGGTAAGGA
GTCAGCTTCCAAAAATGGAAAAAGGTTCGGTGATGTTATTTTGCATCCTCCGCTAGCAAAGAGAATTGAGCACCTAGCTA
CCTCAACCGCCAACACAAAACTCCACCAGGCTCCTTTCCGAAATATTCTTCTCCACGGTCCTCCAGGAACAGGAAAAACA
ATGGCGGCCAGAGAGCTGGCTCGTAAATCTGGTTTGGATTATGCACTGATGACTGGTGGAGATGTTGCTCCCCTTGGAGC
TCAGGCTGTTACAAAGATTCACGAACTGTTTGATTGGGGCAAAAAGTCTAAGAGAGGTTTATTGCTCTTCATTGATGAAG
CCGATGCATTTTTGTGCGAGAGGAACAAAACATACATGAGTGAAGCCCAAAGGAGTGCTCTAAATGCTCTTCTCTTCCGC
ACGGGTGATCAATCCAAAGACATAGTCTTAGCACTAGCTACAAACCGACCTGGTGACTTAGACTCAGCTGTGGCTGACCG
TGTCGATGAAGTTCTCGAATTCCCCTTACCTGGAGAAGAAGAGCGGTTCAAGCTTTTAAACCTCTATCTAGAAAAGTACA
TAGCTGAGGCTGGTCCAAGCAAGCCGGGTTTGTTCGACCGCCTCTTCAAGAAAGAACAGCAGAAGATCGAGATAAAGGGT
GTCACGGAGGAGCTCTTAAAGGAAGCGGCTGCAAAAACCGAAGGGTTTTCAGGTAGAGAAATTGCGAAACTGATGGCAAG
TGTTCAAGCAGCTGTGTATGGAAGTGAGGACTGTGTGTTGGACTCTATGCTTTTCAGAGAGGTTGTTGATTACAAAGTTG
CAGAGCATCAACAGAGAAGGAAATTGGCTGGAGTCGATTCAAAATGA