Details for Arabidopsis Locus AT3G03010

Position : Chr3 ( 5`- 678688 .. 680605 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03010

Protein [Map View]
MDLVWLLSVLLVGAALGYYISTLRQTRRIFLSSKSVAIDAGSSGNKKTKSKEPLEIEKLADFRKNFKMVLVVRNDLKMGK
GKIAAQCSHATLGLYKKLLQRAPKALNRWEYCAQPKVVVKIESEEEMLVLQERAKTLKLPTHITIDAGKTQIAPNSRTVM
AILGPVDNVDEVTGGLKLM*

DNA
ATGGATTTGGTGTGGTTATTAAGTGTTTTACTTGTTGGAGCTGCACTTGGATATTACATCAGCACTTTACGACAAACCCG
CCGAATCTTTCTCTCCTCCAAATCTGTCGCCATAGATGCAGGATCCAGCGGGAATAAGAAAACCAAGTCCAAGGAACCCC
TCGAGATAGAGAAACTCGCTGATTTTCGCAAAAATTTCAAAATGGTTTTGGTTGTGAGGAATGATCTTAAAATGGGTAAA
GGGAAGATTGCAGCTCAATGCAGTCATGCAACTTTAGGTTTATACAAGAAACTCCTTCAACGGGCGCCAAAAGCCTTGAA
CAGATGGGAATATTGTGCTCAGCCAAAAGTTGTTGTCAAAATTGAAAGTGAGGAAGAGATGCTAGTTTTGCAAGAAAGAG
CAAAGACCCTGAAACTGCCAACCCATATCACCATTGATGCGGGAAAAACACAGATCGCTCCAAATTCAAGGACAGTAATG
GCTATTCTTGGACCTGTTGATAATGTTGATGAAGTAACAGGTGGACTAAAGCTTATGTAA