Details for Arabidopsis Locus AT3G03000

Position : Chr3 ( 5`- 677240 .. 678084 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03000

Protein [Map View]
MSCDGGKPAPAKLGDEQLAELREIFRSFDQNKDGSLTELELGSLLRSLGLKPSQDQLDTLIQKADRNNNGLVEFSEFVAL
VEPDLVKCPYTDDQLKAIFRMFDRDGNGYITAAELAHSMAKLGHALTAEELTGMIKEADRDGDGCIDFQEFVQAITSAAF
DNAWG*

DNA
ATGAGCTGCGACGGAGGCAAACCGGCGCCGGCGAAACTAGGCGACGAACAACTAGCGGAGCTCCGGGAGATATTCCGATC
ATTTGACCAGAACAAGGATGGAAGTTTGACGGAGCTCGAGTTAGGCTCACTTCTAAGATCTCTCGGTCTAAAGCCGAGTC
AAGACCAACTCGACACATTGATCCAGAAAGCAGATCGGAATAACAACGGACTGGTCGAGTTCTCCGAGTTCGTCGCCCTC
GTCGAGCCAGATCTGGTCAAGTGTCCTTACACGGATGATCAGCTTAAAGCCATCTTTAGAATGTTTGACCGCGATGGAAA
CGGTTACATAACGGCGGCGGAGTTAGCCCATTCGATGGCGAAGCTAGGTCACGCGTTGACGGCGGAGGAGTTAACGGGAA
TGATCAAAGAAGCTGATCGAGACGGCGATGGTTGTATTGATTTCCAAGAGTTTGTTCAAGCGATTACTTCAGCTGCGTTT
GATAATGCTTGGGGTTGA