Details for Arabidopsis Locus AT3G02990

Position : Chr3 ( 5`- 673472 .. 676403 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02990

Protein [Map View]
MGTVCESVATAKSSTAVMSSIPPFLSKTYDMVDDPLTDDVVSWSSGNNSFVVWNVPEFAKQFLPKYFKHNNFSSFVRQLN
TYGFRKVDPDRWEFANEGFLRGQKQILKSIVRRKPAQVQPPQQPQVQHSSVGACVEVGKFGLEEEVERLQRDKNVLMQEL
VRLRQQQQVTEHHLQNVGQKVHVMEQRQQQMMSFLAKAVQSPGFLNQFSQQSNEANQHISESNKKRRLPVEDQMNSGSHG
VNGLSRQIVRYQSSMNDATNTMLQQIQQMSNAPSHESLSSNNGSFLLGDVPNSNISDNGSSSNGSPEVTLADVSSIPAGF
YPAMKYHEPCETNQVMETNLPFSQGDLLPPTQGAAASGSSSSDLVGCETDNGECLDPIMAVLDGALELEADTLNELLPEV
QDSFWEQFIGESPVIGETDELISGSVENELILEQLELQSTLSNVWSKNQQMNHLTEQMGLLTSDALRK*

DNA
ATGGGAACGGTTTGCGAATCTGTAGCGACGGCGAAATCTTCGACGGCGGTGATGAGCTCCATTCCGCCTTTTCTGAGCAA
AACGTACGATATGGTTGACGATCCATTGACGGACGACGTGGTGTCTTGGAGCAGCGGAAACAACAGCTTCGTGGTTTGGA
ACGTGCCTGAGTTCGCCAAACAGTTTCTACCAAAGTATTTCAAGCACAACAATTTCTCCAGCTTCGTCAGACAGCTCAAT
ACTTATGGTTTTAGAAAAGTTGATCCAGACCGCTGGGAGTTTGCAAACGAGGGCTTTTTAAGAGGCCAAAAGCAAATACT
AAAGAGTATTGTCCGGCGAAAACCTGCACAAGTGCAGCCTCCACAACAACCTCAAGTTCAGCACTCATCTGTGGGTGCGT
GCGTTGAAGTGGGCAAATTTGGACTCGAAGAGGAAGTGGAAAGACTTCAGCGCGATAAGAACGTCCTTATGCAGGAACTT
GTAAGGTTGAGGCAGCAACAACAAGTTACCGAACATCATCTGCAGAATGTGGGGCAGAAAGTTCATGTGATGGAGCAGAG
GCAGCAACAGATGATGTCCTTTCTAGCAAAGGCTGTCCAAAGTCCAGGTTTCTTAAACCAATTTTCTCAGCAGAGTAATG
AAGCAAACCAACACATTTCTGAAAGCAACAAAAAGAGGAGGCTACCTGTTGAGGACCAGATGAATTCTGGCAGTCATGGG
GTTAATGGTCTTAGCCGCCAGATTGTGAGATATCAGTCATCGATGAACGATGCAACAAACACTATGCTTCAACAGATACA
GCAGATGAGTAATGCACCTAGCCATGAATCTCTCTCAAGCAATAATGGTAGCTTTCTTTTGGGCGATGTTCCAAATTCTA
ACATTTCAGACAATGGGAGCTCCTCAAATGGATCACCTGAAGTTACATTGGCAGATGTTTCATCCATTCCTGCAGGCTTC
TATCCTGCAATGAAGTACCACGAGCCTTGTGAAACAAATCAAGTCATGGAGACCAATTTGCCTTTTTCTCAAGGTGATCT
CTTACCTCCAACGCAAGGAGCAGCAGCTTCTGGGAGCTCAAGTTCGGATCTTGTTGGATGCGAGACAGATAATGGAGAGT
GTTTGGATCCAATAATGGCTGTTTTGGATGGCGCACTCGAACTAGAAGCTGATACCTTAAATGAGTTGCTTCCTGAAGTC
CAAGATTCTTTTTGGGAACAGTTCATTGGTGAGAGCCCAGTGATTGGTGAGACAGATGAGTTAATCTCAGGATCAGTGGA
AAATGAACTGATATTGGAGCAACTAGAGTTACAATCAACCCTGAGTAATGTGTGGAGCAAGAATCAACAAATGAACCATC
TTACTGAACAGATGGGACTTCTCACATCAGATGCTCTCAGAAAATGA