Details for Arabidopsis Locus AT3G02980

Position : Chr3 ( 5`- 670897 .. 672215 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02980

Protein [Map View]
MSRFPRRFIDDSSMEDAGISLCPSIHYRPINPNDLDRLEQIHRDIFPIKYESEFFQSVVNGVDIVSWAAVDRSRPDDHSD
ELIGFVTAKFVLAKDSEIDDLIHYDSSKGEETLIYILTLGVVETYRNRGIAMSLISEVIKYASGLSVCRGVYLHVIAHNN
AAICLYKRLMFRCVRRLHGFYLINRHHFDAFLFVYFINGSRTPCSPLEVAMFVVNYMKSGIKSVASKLANKDEKGLKWLF
CKDTDCV*

DNA
ATGTCGCGATTTCCTCGAAGATTCATAGATGATTCATCAATGGAAGATGCAGGAATCTCTCTTTGCCCAAGTATTCACTA
TAGACCTATAAACCCTAATGATCTAGATCGTTTGGAGCAAATCCATCGCGATATCTTCCCCATCAAGTATGAGTCTGAGT
TTTTCCAGAGTGTTGTGAACGGAGTTGATATCGTCTCATGGGCTGCTGTTGATCGGAGCCGGCCTGATGATCACTCTGAT
GAACTTATTGGTTTTGTTACTGCCAAATTTGTGCTTGCCAAAGATAGCGAGATAGATGATCTTATACATTACGATTCCTC
GAAAGGAGAGGAGACTTTGATATACATCTTGACACTCGGAGTTGTAGAAACATACAGAAACCGTGGAATCGCAATGTCAC
TTATTAGTGAGGTAATTAAATATGCTTCCGGTTTATCTGTGTGTCGCGGAGTTTACCTTCATGTGATTGCACACAACAAT
GCTGCGATCTGTTTGTACAAAAGATTGATGTTCAGATGCGTGCGGAGATTACATGGATTTTATCTAATCAATCGACATCA
TTTTGATGCGTTCTTGTTTGTCTACTTCATCAACGGTTCTCGAACTCCTTGCTCACCCTTAGAGGTGGCGATGTTTGTTG
TGAATTATATGAAGAGTGGTATCAAGTCAGTGGCATCTAAGCTGGCTAACAAGGATGAGAAAGGTTTGAAATGGCTGTTT
TGCAAAGACACGGATTGTGTCTAA