Details for Arabidopsis Locus AT3G02970

Position : Chr3 ( 5`- 669103 .. 670541 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02970

Protein [Map View]
MAMASASSSSSSISVIIFLLLAPLCLSREPPSQIPNGTLDLSLLWYGQFTPTQKERVHDFIESLNFDAKEGLDPKVSAWW
KVVESYQERFEVKDIYRQKKSNRTVAPRIKVKVVRSYVDEKMKYGKELTMGNGEKLVETAIGNMSKVVPVVLLSAQVRAH
GVGFCDGTCQHNALAKIKGQKEPRRYIMVSNPEVECPGECAWPFHTADKGPRGMTYQPASGEVGADALVIQLATGLADLA
TNPDLTKSLFKSETTPYNDDVKKNHESSSMYIVDPATKCTRVFGSGAFPGFTGRIRVDPITGGAFNSHGINHLKFLIPSI
WDPKTKSCWTPM*

DNA
ATGGCAATGGCGTCTGCTTCTTCCTCCTCCTCCTCCATATCCGTCATCATTTTCCTCCTCTTGGCGCCTCTCTGCCTTTC
ACGTGAGCCACCTTCACAAATCCCAAACGGAACCCTAGATCTCTCTTTACTATGGTACGGCCAATTCACGCCTACTCAAA
AGGAGAGGGTTCACGATTTCATAGAATCGCTTAACTTCGACGCCAAGGAAGGTCTTGACCCGAAGGTATCGGCGTGGTGG
AAAGTGGTGGAGAGTTACCAAGAGAGGTTTGAGGTGAAGGATATTTACCGACAGAAGAAGAGTAACAGAACCGTAGCTCC
GAGGATTAAGGTGAAGGTTGTCCGGAGTTATGTGGATGAGAAGATGAAGTATGGAAAGGAATTGACAATGGGGAACGGTG
AGAAACTTGTTGAGACGGCTATCGGAAATATGTCGAAAGTGGTTCCCGTGGTATTACTTTCGGCGCAAGTTAGGGCTCAT
GGCGTAGGGTTTTGTGACGGAACTTGCCAACATAACGCCCTAGCCAAAATTAAAGGTCAAAAAGAACCACGACGGTACAT
AATGGTAAGCAACCCGGAGGTGGAATGTCCCGGAGAGTGCGCTTGGCCTTTCCACACGGCCGATAAGGGTCCACGTGGCA
TGACCTATCAACCGGCAAGTGGAGAAGTCGGAGCTGACGCACTGGTTATTCAGCTAGCCACCGGTTTAGCCGATTTGGCC
ACCAATCCAGATCTAACCAAGTCCTTATTCAAATCTGAGACGACACCGTACAACGATGACGTAAAGAAAAACCATGAATC
TTCGTCAATGTATATTGTGGACCCTGCAACCAAGTGCACTCGGGTTTTTGGATCCGGAGCTTTTCCAGGTTTCACTGGTA
GAATTCGGGTTGACCCGATTACTGGTGGAGCCTTTAATTCACACGGAATCAACCACTTGAAATTCTTGATTCCTTCTATT
TGGGACCCTAAGACCAAATCTTGCTGGACTCCTATGTAA