Details for Arabidopsis Locus AT3G02960

Position : Chr3 ( 5`- 667245 .. 668626 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02960

Protein [Map View]
MGKNKQNGESDNKSEKKNQKNGDSSVDKSDKKNQCKEIVLKVYMHCEGCASQVSHCLRGYDGVEHIKTEIGDNKVVVSGK
FDDPLKILRRVQKKFSRNAEMISPKHNPKQDQKEPQQKKESAPEIKTAILRMNMHCEGCVHEIKRGIEKIKGIQSVEPDR
SKSTVVVRGVMDPPKLVEKIKKKLGKHAELLSQITEKGKDNNKKNNNKKEESDGNKIFSYPPQYSSQHAYPSQIFSDENV
HSCSIM*

DNA
ATGGGAAAGAACAAGCAAAATGGAGAATCAGACAACAAGTCTGAAAAGAAGAACCAGAAAAATGGAGATTCATCAGTCGA
TAAGTCTGATAAGAAAAATCAATGTAAAGAAATTGTTCTGAAGGTTTACATGCACTGTGAAGGATGTGCATCACAAGTTT
CTCATTGCTTGAGGGGCTATGATGGGGTTGAGCATATTAAGACAGAGATAGGAGACAATAAAGTTGTTGTGTCTGGAAAA
TTTGATGATCCGTTGAAGATATTACGAAGAGTGCAAAAGAAATTTAGTAGAAATGCTGAGATGATTTCCCCAAAACATAA
CCCTAAACAAGATCAGAAGGAGCCACAGCAAAAGAAAGAAAGTGCTCCCGAGATCAAAACTGCAATTTTAAGAATGAACA
TGCACTGTGAAGGATGTGTTCATGAAATCAAAAGAGGCATTGAAAAAATAAAAGGCATTCAATCGGTGGAACCAGACCGG
TCAAAGTCAACGGTAGTGGTACGAGGAGTCATGGATCCTCCAAAACTTGTGGAGAAAATCAAGAAAAAACTTGGGAAACA
TGCAGAGCTTCTAAGTCAAATTACAGAGAAAGGCAAAGACAATAATAAGAAGAACAATAATAAGAAGGAAGAAAGTGATG
GAAACAAAATCTTTAGTTACCCTCCTCAGTATTCATCTCAACATGCTTATCCCTCTCAGATTTTTAGCGACGAAAATGTA
CATTCTTGTTCAATCATGTGA