Details for Arabidopsis Locus AT3G02930

Position : Chr3 ( 5`- 655056 .. 658637 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02930

Protein [Map View]
MASKIKNGLSDTTLRKSSSTSLRVPRLTRIVTKPDSNSPSPTQQQSRLSFERPSSNSKPSTDKRSPKAPTPPEKTQIRAV
RVSESQPQSVQIKEDLKKANELIASLENEKAKALDQLKEARKEAEEASEKLDEALEAQKKSLENFEIEKFEVVEAGIEAV
QRKEEELKKELENVKNQHASESATLLLVTQELENVNQELANAKDAKSKALCRADDASKMAAIHAEKVEILSSELIRLKAL
LDSTREKEIISKNEIALKLGAEIVDLKRDLENARSLEAKVKELEMIIEQLNVDLEAAKMAESYAHGFADEWQNKAKELEK
RLEEANKLEKCASVSLVSVTKQLEVSNSRLHDMESEITDLKEKIELLEMTVASQKVDLEKSEQKLGIAEEESSKSEKEAE
KLKNELETVNEEKTQALKKEQDATSSVQRLLEEKKKILSELESSKEEEEKSKKAMESLASALHEVSSESRELKEKLLSRG
DQNYETQIEDLKLVIKATNNKYENMLDEARHEIDVLVNAVEQTKKQFESAMVDWEMREAGLVNHVKEFDEEVSSMGKEMN
RLGNLVKRTKEEADASWEKESQMRDCLKEVEDEVIYLQETLREAKAETLKLKGKMLDKETEFQSIVHENDELRVKQDDSL
KKIKELSELLEEALAKKHIEENGELSESEKDYDLLPKVVEFSEENGYRSAEEKSSKVETLDGMNMKLEEDTEKKEKKERS
PEDETVEVEFKMWESCQIEKKEVFHKESAKEEEEDLNVVDQSQKTSPVNGLTGEDELLKEKEKKKKKTLFGKVGNLLKKK
GPVNQK*

DNA
ATGGCTTCTAAGATTAAAAATGGTTTATCTGACACTACTTTGAGGAAATCATCTTCAACATCTCTAAGAGTGCCTAGACT
CACTCGGATTGTGACTAAACCTGATTCTAATTCTCCTTCACCGACTCAACAACAGTCACGGCTTTCGTTCGAGCGCCCTT
CTTCTAACTCAAAGCCTAGTACTGATAAGAGGTCCCCCAAAGCTCCAACCCCACCAGAAAAAACTCAAATACGGGCTGTG
AGAGTATCAGAATCGCAACCTCAGTCAGTTCAAATCAAGGAAGATTTAAAGAAAGCCAATGAGCTGATAGCATCGCTCGA
GAATGAAAAAGCTAAAGCACTTGATCAACTTAAAGAAGCGCGGAAAGAAGCTGAAGAGGCATCTGAGAAACTAGATGAGG
CTTTAGAAGCTCAGAAAAAGTCCCTGGAGAACTTCGAAATTGAGAAATTTGAGGTTGTTGAGGCAGGGATAGAGGCGGTT
CAGAGAAAAGAAGAAGAGTTGAAGAAAGAACTAGAGAATGTCAAGAACCAACATGCTTCAGAATCAGCTACTCTTCTTTT
GGTAACACAGGAGCTGGAGAATGTCAATCAAGAATTGGCTAATGCTAAAGATGCCAAGAGTAAGGCTTTGTGTCGTGCAG
ATGATGCTAGTAAGATGGCTGCAATTCATGCAGAGAAAGTTGAAATCTTGTCGTCAGAGTTAATACGGTTGAAGGCTTTG
CTTGATTCAACTCGAGAGAAGGAAATCATCTCCAAGAATGAGATTGCTTTAAAGCTAGGGGCGGAGATAGTGGATCTAAA
AAGAGACCTTGAGAATGCGAGAAGTTTGGAAGCAAAGGTCAAGGAACTAGAGATGATCATTGAGCAGCTTAATGTTGACT
TAGAAGCTGCAAAAATGGCAGAATCTTATGCGCATGGCTTTGCTGACGAGTGGCAAAACAAAGCGAAAGAACTGGAGAAA
CGGTTGGAAGAAGCTAACAAGCTGGAGAAATGTGCTTCGGTATCTCTGGTATCTGTGACAAAGCAGCTGGAAGTAAGCAA
TAGTAGATTGCACGATATGGAATCTGAAATTACTGATCTTAAGGAGAAAATTGAGTTATTGGAGATGACAGTTGCTAGTC
AAAAGGTTGATCTTGAGAAATCTGAACAGAAGCTAGGTATTGCAGAAGAAGAATCATCTAAGAGTGAAAAAGAAGCAGAG
AAACTGAAGAATGAGCTTGAAACTGTGAATGAAGAGAAAACCCAGGCTTTAAAGAAGGAGCAAGATGCTACTTCAAGTGT
GCAAAGGCTCTTGGAAGAAAAAAAGAAGATCTTGTCAGAACTGGAGAGCTCGAAGGAGGAAGAGGAGAAGAGTAAGAAAG
CAATGGAGAGTTTAGCTTCAGCATTGCACGAAGTGTCAAGTGAATCACGTGAGTTGAAAGAAAAATTGCTGAGTCGAGGT
GATCAAAATTATGAAACACAGATAGAAGATCTGAAGTTGGTGATTAAAGCAACGAACAACAAGTACGAGAACATGCTTGA
CGAGGCGAGACATGAGATCGATGTTCTTGTCAATGCGGTAGAACAAACCAAGAAACAGTTTGAGAGCGCAATGGTAGATT
GGGAGATGAGAGAAGCCGGTTTGGTGAATCACGTGAAGGAATTTGATGAAGAAGTTTCTTCAATGGGGAAAGAAATGAAT
AGGTTGGGCAATTTGGTTAAAAGGACAAAGGAAGAAGCTGATGCATCATGGGAAAAAGAATCCCAAATGAGAGATTGTCT
TAAAGAAGTGGAAGATGAGGTGATTTATCTTCAGGAAACTCTCAGGGAAGCGAAAGCTGAAACCTTGAAACTAAAGGGGA
AGATGTTGGATAAAGAAACTGAGTTTCAAAGCATTGTTCATGAGAACGATGAACTCAGAGTGAAACAGGATGATTCTCTG
AAGAAGATCAAGGAACTATCGGAGTTACTCGAAGAAGCATTGGCCAAGAAACATATTGAAGAGAACGGTGAGCTCAGTGA
GAGTGAAAAAGACTATGATTTGCTGCCAAAGGTGGTTGAGTTTTCTGAGGAAAATGGTTATAGAAGTGCAGAAGAGAAGT
CTTCTAAAGTAGAGACCCTCGATGGCATGAACATGAAACTTGAGGAGGACACCGAGAAGAAGGAAAAGAAAGAACGTTCT
CCAGAGGATGAGACAGTTGAAGTTGAATTCAAAATGTGGGAAAGTTGTCAGATTGAGAAGAAAGAAGTTTTTCATAAAGA
GTCTGCAAAAGAAGAAGAGGAAGACTTAAATGTGGTGGACCAAAGCCAGAAAACCTCGCCAGTAAATGGATTAACCGGAG
AAGATGAGCTGTTGAAAGAGAAAGAGAAGAAGAAGAAGAAGACATTGTTTGGTAAAGTTGGGAATCTTCTCAAGAAGAAA
GGACCCGTGAATCAGAAATAA