Details for Arabidopsis Locus AT3G02885

Position : Chr3 ( 5`- 638021 .. 639055 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02885

Protein [Map View]
MANCIRRNALFFLTLLFLLSVSNLVQAARGGGKLKPQQCNSKCSFRCSATSHKKPCMFFCLKCCKKCLCVPPGTFGNKQT
CPCYNNWKTKEGRPKCP*

DNA
ATGGCGAATTGTATCAGAAGAAATGCTCTTTTCTTCTTGACTCTTCTCTTTTTATTGTCAGTCTCCAACCTCGTTCAGGC
TGCTCGTGGTGGTGGCAAACTCAAACCCCAACAGTGCAACTCAAAGTGTAGCTTCCGTTGTTCAGCAACATCACACAAGA
AGCCATGCATGTTCTTTTGCCTCAAGTGTTGCAAAAAATGTCTTTGTGTTCCTCCTGGCACTTTCGGCAACAAACAAACT
TGTCCATGTTACAACAACTGGAAGACTAAAGAAGGCCGTCCAAAATGTCCTTAA