Details for Arabidopsis Locus AT3G02875

Position : Chr3 ( 5`- 631913 .. 634074 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02875

Protein [Map View]
MDFSGSFFVIFVTFFFLPPLSSAGSYDSGSGLESLARGMLHSAKDPEFFEWMRGIRRKIHENPETGFQEFKTSQLVRDEL
DSLGVKYKYPVAKTGVVAWIGSCSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAAKLLQTTKHL
IKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVFPSIPSGGIGSRPGTVLAGAGLFTVTVHGQGSHAATPHFSK
DPVLAASSAVVALQQIVSRELDPLEAGVVTVGYIEGGHAQNVIPQSAKFGGTFRSLSNDGLLFIQRRIKEISEAQASVYR
CKAEVNFEEKKPSLHPVMNNDEGLYEHGKKVAEAMIGKNNFHDFPVTMGGEDFSFFTQKTKAAIFVLGVKNETLGAGKPL
HSPYFFVDEEALPVGAALHAAMAVSYLDEHGHSHEEEVKSEL*

DNA
ATGGATTTCTCAGGGAGCTTCTTTGTCATCTTCGTTACCTTCTTCTTTCTCCCTCCTCTGTCTTCAGCTGGGAGCTACGA
TTCTGGTTCGGGTCTCGAGTCACTCGCTCGCGGGATGCTTCATTCAGCCAAGGATCCTGAGTTCTTCGAGTGGATGAGAG
GAATTAGGAGAAAGATTCATGAGAACCCAGAGACAGGGTTTCAGGAGTTCAAAACGAGTCAACTCGTTCGAGACGAGCTT
GACTCGCTTGGAGTGAAGTATAAGTATCCTGTGGCGAAGACTGGCGTCGTCGCTTGGATCGGATCCTGTTCGAAACCTGT
TTTCGGACTTAGAGCCGACATGGACGCACTTCCGTTACAGGAATTAGTGGAATGGGAATCGAAAAGTAAAGTAGATGGAA
AGATGCATGCTTGTGGTCATGATACTCATGTTGCTATGCTTCTTGGTGCTGCTAAGCTTCTTCAAACCACAAAACACCTC
ATCAAGGGGACAGTAAAACTTGTGTTTCAACCAGGCGAGGAAGGTTATGCAGGTGCTTATGAAATGCTAAAAGACGAGAT
TCTAGACGACTTAGATGGGATACTCAGTGTTCATGTCTTTCCATCGATCCCATCAGGTGGTATTGGTTCTAGGCCTGGGA
CCGTTCTTGCAGGTGCAGGATTGTTTACAGTCACGGTTCACGGTCAAGGTAGCCACGCAGCTACACCGCACTTCTCTAAA
GACCCGGTTCTTGCAGCTTCTTCCGCTGTTGTTGCCTTGCAACAGATTGTTTCGCGGGAACTGGATCCACTCGAAGCTGG
TGTGGTTACAGTTGGATATATTGAAGGAGGTCATGCTCAAAACGTAATACCGCAGAGTGCGAAATTTGGAGGTACTTTCA
GAAGCTTAAGCAACGATGGGCTTCTATTTATCCAAAGACGGATCAAAGAGATTTCAGAGGCACAAGCATCGGTATACCGA
TGCAAAGCAGAAGTAAACTTCGAAGAGAAAAAGCCGTCGCTTCACCCGGTAATGAATAACGACGAGGGCTTATACGAGCA
CGGTAAAAAAGTAGCGGAAGCGATGATTGGAAAGAATAACTTCCATGATTTCCCGGTGACAATGGGAGGAGAGGATTTCA
GCTTCTTCACTCAAAAGACTAAGGCTGCGATTTTCGTGCTGGGGGTAAAGAATGAGACGCTAGGCGCTGGTAAGCCGCTT
CACTCGCCTTACTTCTTTGTTGATGAAGAAGCTCTTCCTGTTGGGGCTGCTCTTCACGCAGCTATGGCCGTTTCTTATTT
GGACGAACATGGTCATAGCCATGAAGAAGAGGTTAAGAGTGAATTATAG