Details for Arabidopsis Locus AT3G02830

Position : Chr3 ( 5`- 613802 .. 616144 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02830

Protein [Map View]
MDFNAGVPMSSLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG
EYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQ
PTNMMVPTSGQQSYPWSRASFIASPRWQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRNLQQNETIES
GSQSQGSFSGYNPGSSVPLGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR
PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASETDEVVETSTGKSRRLSVSETRQAATTSSGKDTTIDNTQQ*

DNA
ATGGATTTTAATGCCGGAGTTCCCATGTCTTCTCTTTCACCTTTGATGAATCAAGATGCAATGTGGCAAATGAATTTGAG
TTCAGATGAAACAATGGAAACTGGTTCTTACCCTGAACGACCAGGAGAGCCTGATTGTTCTTATTACATAAGAACTGGTC
TTTGTAGATTTGGCTCTACTTGTCGGTTCAACCATCCTCGTGATCGGGAACTGGTTATAGCTACTGCAAGGATGAGAGGA
GAATACCCTGAAAGGATTGGTCAGCCTGAATGCGAGTACTATTTGAAGACAGGAACCTGCAAGTTTGGAGTAACATGTAA
GTTTCATCATCCAAGGAACAAAGCTGGGATTGCTGGAAGAGTCTCTCTCAATATGTTAGGCTATCCTCTACGCTCGAATG
AGGTTGATTGTGCTTATTTCCTAAGAACCGGACACTGTAAATTTGGTGGTACTTGTAAATTCAACCACCCTCAGCCTCAA
CCAACCAACATGATGGTTCCTACCTCAGGGCAACAGTCTTATCCTTGGTCAAGAGCTTCTTTTATTGCCAGCCCTCGTTG
GCAAGATCCGTCTAGCTACGCTTCCTTAATCATGCCTCAAGGAGTTGTCCCGGTTCAAGGATGGAACCCTTACAGTGGTC
AGCTCGGCTCAGTTTCTCCTTCAGGTACCGGAAATGATCAAAACTACAGAAATTTACAGCAGAACGAGACAATAGAGTCA
GGCTCTCAGTCTCAAGGATCATTCTCGGGTTACAATCCGGGATCCTCTGTTCCGCTAGGAGGGTATTATGCATTGCCGAG
GGAAAATGTGTTCCCGGAGAGACCAGGACAACCCGAATGCCAATTCTACATGAAGACAGGTGACTGCAAATTTGGCACAG
TTTGCAAATTTCACCATCCTAGAGACAGACAAGCTCCTCCTCCTGATTGTCTCTTAAGCTCCATTGGCCTCCCCTTACGC
CCGGGAGAACCGTTGTGTGTGTTCTATACACGCTATGGAATCTGCAAATTTGGTCCAAGCTGTAAATTTGATCACCCAAT
GCGAGTATTCACATACGACAACACAGCTTCAGAGACAGATGAGGTAGTGGAAACATCAACAGGGAAATCTAGAAGACTCT
CTGTGTCTGAAACAAGACAAGCAGCAACAACATCCTCTGGTAAAGACACTACCATTGATAATACACAGCAGTGA