Details for Arabidopsis Locus AT3G02810

Position : Chr3 ( 5`- 608460 .. 610985 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02810

Protein [Map View]
MHCFPCFSSPKNKKSSTTNETNDNNEPKPDDRRRAEETEEIEQSEGTSLKIFTFRELATATKNFRQECLLGEGGFGRVYK
GTLKSTGQVVAVKQLDKHGLHGNKEFQAEVLSLGQLDHPNLVKLIGYCADGDQRLLVYDYISGGSLQDHLHEPKADSDPM
DWTTRMQIAYAAAQGLDYLHDKANPPVIYRDLKASNILLDDDFSPKLSDFGLHKLGPGTGDKMMALSSRVMGTYGYSAPE
YTRGGNLTLKSDVYSFGVVLLELITGRRALDTTRPNDEQNLVSWAQPIFRDPKRYPDMADPVLENKFSERGLNQAVAIAS
MCVQEEASARPLISDVMVALSFLSMPTEDGIPTTVPILSFKDKSMSIALSRHDSNLVSPPPELATEDDKSSTSSGEESSL
ESEKESVSKNEYKKKHEEEDSSMESDDESDSNSEHEKDQPPKPIDEKNQAQSLKIKYRYSWEDIDVNDERLSSKSSQKSN
DESTSSRYDSDRDQDEKGKEEEEEEEAEEKHTHIEHIDSSKTDDDQSVYFDNDDDSGDDNGGSLHRIKSDVAIDSIKE*

DNA
ATGCACTGTTTTCCGTGTTTCTCTTCGCCAAAGAACAAGAAATCTTCAACTACGAATGAGACCAACGACAACAACGAACC
CAAACCAGATGATAGGAGACGTGCAGAAGAAACAGAGGAAATAGAGCAATCGGAAGGAACATCGTTGAAGATATTCACTT
TCCGGGAATTAGCTACAGCCACAAAGAATTTCCGGCAAGAGTGTTTGCTAGGAGAAGGTGGATTTGGTAGGGTTTACAAA
GGAACCCTCAAATCTACTGGCCAGGTGGTGGCTGTAAAGCAACTAGACAAGCATGGATTACATGGAAACAAAGAGTTTCA
AGCTGAGGTTTTGTCTTTAGGCCAACTTGATCATCCGAATCTTGTTAAGCTTATTGGTTACTGCGCGGATGGAGATCAAA
GGCTTTTGGTCTATGATTATATCTCTGGAGGTTCACTTCAAGACCATCTTCATGAACCAAAAGCAGACAGTGATCCGATG
GATTGGACAACTAGGATGCAGATAGCGTATGCTGCAGCGCAAGGGCTTGATTACTTGCACGATAAAGCGAATCCACCCGT
GATATACAGAGATTTGAAAGCTTCAAACATTTTGTTAGATGATGACTTTTCTCCTAAGCTTTCTGATTTTGGTCTACATA
AGCTAGGACCCGGGACAGGTGATAAGATGATGGCTTTATCTTCACGAGTAATGGGAACTTATGGTTACTCTGCACCTGAG
TATACACGAGGCGGAAATCTCACTTTGAAATCAGATGTCTATAGCTTTGGTGTTGTGTTGCTTGAGCTTATCACGGGTCG
AAGAGCTCTTGATACTACTAGGCCTAATGATGAACAGAACTTAGTTTCTTGGGCACAACCGATATTTAGAGATCCGAAGA
GGTATCCCGATATGGCAGATCCAGTTTTGGAGAATAAATTCTCAGAGAGAGGATTAAACCAAGCAGTGGCAATAGCTTCA
ATGTGTGTGCAAGAGGAAGCATCAGCTCGTCCTCTTATAAGCGATGTAATGGTTGCGCTTAGCTTCCTTTCGATGCCTAC
AGAAGATGGTATTCCCACAACAGTTCCTATCTTATCCTTCAAAGACAAGAGCATGTCTATAGCCTTAAGCCGACATGATT
CAAATCTTGTATCTCCTCCTCCTGAGCTAGCTACGGAAGATGACAAATCTAGTACCTCATCAGGCGAAGAATCATCTTTG
GAGAGCGAAAAGGAGAGTGTGAGTAAGAATGAGTATAAGAAGAAACATGAAGAGGAAGATAGCTCAATGGAATCTGATGA
TGAGTCTGATTCTAACTCTGAACATGAAAAGGACCAACCACCAAAGCCTATTGATGAGAAGAACCAGGCGCAAAGCTTGA
AGATAAAGTATAGATATAGCTGGGAAGATATTGATGTCAATGATGAGAGGCTAAGCAGTAAAAGCAGCCAAAAATCAAAC
GACGAAAGTACTTCTTCGCGTTATGATAGCGACAGAGATCAAGACGAGAAAGGGAAAGAAGAAGAGGAAGAGGAAGAGGC
AGAAGAAAAGCATACTCATATTGAACACATTGATAGCTCAAAAACTGATGATGATCAAAGTGTTTACTTTGATAATGATG
ATGATTCAGGAGATGACAATGGAGGCTCTTTGCATCGGATAAAATCAGATGTTGCGATCGATTCTATTAAAGAGTGA