Details for Arabidopsis Locus AT3G02800

Position : Chr3 ( 5`- 606471 .. 607886 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02800

Protein [Map View]
MCLIMETDDHNGDVLAPPSNFSMVEDGIYRSGFPRPENFSFLKTLNLRSIIYLCPEPYPEENLKFLEANNIKLYQFGIEG
KTDPPTPMPKDTVLDALKVLVDVRNHPILIHCKRGKHRTGCLVGCLRKVQSWCLSSVLEEYQKNAGLKWRQRDLNFIEAF
DIVSLRQCLLSIMYQYHGYGFKRRRLAYEEENVKTPKPQAARV*

DNA
ATGTGTTTGATTATGGAAACGGATGATCACAACGGTGATGTTTTAGCGCCGCCGTCGAATTTCTCGATGGTTGAAGATGG
AATTTATCGATCTGGGTTTCCTCGACCTGAGAATTTCAGTTTCCTTAAAACCCTAAATCTTCGTTCCATCATTTATCTGT
GTCCTGAACCATACCCAGAGGAGAATCTCAAGTTTCTTGAGGCTAACAACATTAAGCTTTACCAATTTGGAATCGAAGGC
AAAACGGATCCTCCAACTCCTATGCCAAAAGATACAGTTTTGGATGCTCTCAAAGTTTTAGTTGATGTGAGAAACCATCC
AATTCTCATACATTGCAAACGCGGGAAGCATAGGACAGGTTGTCTAGTGGGATGCTTAAGAAAAGTTCAGAGCTGGTGTT
TATCATCGGTGCTCGAGGAGTACCAGAAGAACGCGGGTTTAAAATGGAGACAAAGGGACTTGAATTTTATAGAGGCATTT
GATATAGTGAGCTTGAGACAGTGTCTCTTGAGCATCATGTATCAGTATCACGGTTATGGCTTCAAGAGGAGAAGGTTGGC
ATATGAAGAAGAGAATGTCAAGACACCAAAACCGCAGGCTGCTAGAGTTTAA