Details for Arabidopsis Locus AT3G02770

Position : Chr3 ( 5`- 600893 .. 602259 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02770

Protein [Map View]
MAFVTTAEVCDANQEMIRSGQLRALQPVFQIYGRRQIFSGPVVTVKVFEDNGLIRHFLEEKGNGRVLVVDGGGSLRCAIL
GGNPVVQAQNNGWAGIIVNGCIRDVDEINGCDIGVRALASHPIKASKKGLGEQRVSLNIAGTRICDGEWLYADTDGILVS
QIELSV*

DNA
ATGGCGTTTGTGACCACTGCGGAAGTGTGTGACGCGAATCAAGAGATGATTCGAAGTGGCCAGCTCCGAGCTCTGCAACC
CGTTTTTCAGATTTATGGTCGTCGTCAAATATTTTCAGGTCCAGTAGTTACTGTTAAAGTCTTTGAAGACAATGGCTTAA
TCCGTCACTTCCTCGAAGAGAAAGGCAATGGTAGAGTTCTTGTGGTGGATGGTGGAGGGAGTTTACGCTGTGCGATACTA
GGAGGAAACCCGGTCGTACAAGCGCAGAACAACGGATGGGCAGGGATCATAGTGAATGGATGCATCAGAGACGTTGATGA
GATCAATGGTTGCGACATTGGAGTGAGAGCTTTAGCTTCTCATCCAATAAAGGCTAGTAAGAAAGGACTTGGTGAACAAA
GAGTCTCTTTGAACATTGCAGGCACTCGGATATGCGATGGCGAATGGCTTTATGCAGATACTGATGGTATCCTTGTTTCT
CAGATTGAATTATCCGTTTAA