Details for Arabidopsis Locus AT3G02760

Position : Chr3 ( 5`- 597359 .. 600650 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02760

Protein [Map View]
MAAERSSITLGGKGSSLSSSSVYNVASGVANVRIDSSAIERFSTRNVPSIKRSSFGIPQGLTNEETRASLAVLLNKLILS
TSGPPSSSTARSVLPLKIVEILNLKAESLELGEIDVTEGENIVLEKSCASLIGICSIIDHKSTTLSQIVDSVAALSCEVT
KADIASFSLLDSGDGNGDKDVIGVAGDLKVLLNGYKGTGKLEIEEISKIPWIHGKFRYVVKSVHADARRELNSGVKGGKT
GSGNTGIGEALGTTLLPLLTAIKNLGVCSFLRAKLCFEKIVDENLKKCLSEKICVENENLKNSYKLAYTAHLEEDYCRFA
HKLNECLGIVWRIVGLEAVAAFFALAGGELFVQKSGDADKEESKTDKKKKKNEKKAVVGKGTSLVIQFIKDRLVSNDAAS
DGDQMHSLMQCGEQILNLFNPEGRSFDSLLDKVKEIVESNENRRLPKLPKGTRDFAKEQMAVREKAFSIIQNVFKRHGAT
ALDTPVFELRETLMGKYGEDSKLVYDIADQGGELCSLRYDLTVPFARYVAMNGITSFKRYQIAKVYRRDNPSKGRYREFY
QCDFDIAGLFEPMGPDFEIVKILTELLDELEIGDYEVKLNHRKLLDGMLEICGVPPEKFRTICSSIDKLDKQSFEQVKKE
MVEEKGLSSEIADRIGNFVKEKGAPLELLSKLRQEGSEFLDNQSSREALDELSIMFEALKRSKCSERIVFDLSLARGLDY
YTGVIFEAVCIGAEVGSIGAGGRYDNLIGMFGTKQVPAVGMSLGIERVFNIMEELNEKQKQVIRPTETQVLVSIMVDNKL
AEAAELVSQLWGAKINAEYLVSKRKEKHFNRAKESGIPWMVMVGEKELSGSFVTLKKLEKGSEEKEDQTCTRDRFVEELK
KLL*

DNA
ATGGCGGCGGAGAGATCGTCCATCACTCTCGGAGGGAAAGGTTCTTCTTTATCTTCTTCCTCCGTTTACAATGTTGCTTC
CGGCGTCGCTAATGTTCGAATTGACTCTTCTGCGATCGAGAGATTCTCCACTAGAAACGTTCCATCGATCAAAAGGAGCT
CCTTTGGTATCCCTCAAGGGTTAACGAACGAAGAAACTCGAGCTTCTCTGGCTGTTCTCTTAAACAAGCTTATTTTGTCG
ACTTCTGGTCCTCCTTCTTCATCCACCGCTCGTTCTGTTCTTCCGCTTAAGATTGTTGAGATTCTGAATTTGAAGGCTGA
GAGTTTGGAATTGGGTGAGATTGATGTGACAGAAGGGGAAAACATTGTGTTGGAGAAGTCGTGTGCTTCGTTGATTGGGA
TTTGTTCTATTATAGATCACAAATCGACGACTCTTTCACAGATTGTGGATTCTGTTGCTGCGTTGAGTTGTGAGGTTACA
AAGGCTGATATAGCTTCGTTTAGCTTGTTGGATTCAGGAGATGGGAATGGTGATAAAGATGTGATTGGTGTTGCTGGTGA
TCTCAAGGTTTTGCTTAACGGGTATAAAGGTACAGGGAAATTAGAAATAGAAGAGATTTCGAAAATCCCTTGGATTCATG
GGAAATTCAGGTATGTGGTGAAAAGCGTGCACGCGGATGCTAGGAGAGAATTGAATTCCGGTGTTAAAGGAGGCAAAACT
GGGTCTGGAAACACTGGGATTGGTGAGGCTTTAGGAACAACATTGTTACCTTTGTTAACGGCGATTAAAAACTTGGGAGT
GTGTTCGTTCCTTCGTGCTAAGCTTTGTTTTGAGAAGATTGTGGATGAGAATCTGAAGAAATGTTTATCTGAAAAGATCT
GTGTTGAGAATGAGAATCTAAAGAATAGCTATAAGTTAGCTTATACTGCTCATTTGGAAGAGGATTACTGCAGGTTTGCT
CACAAACTGAATGAGTGTCTGGGAATTGTATGGAGAATTGTTGGTTTGGAGGCAGTTGCTGCCTTTTTTGCTCTTGCTGG
TGGAGAATTGTTTGTTCAGAAGAGCGGAGATGCGGACAAAGAAGAGTCGAAGACCGATAAGAAAAAGAAGAAGAATGAGA
AAAAAGCAGTTGTGGGAAAGGGGACAAGCCTAGTTATCCAGTTTATCAAAGATAGATTGGTGAGTAATGACGCAGCAAGT
GATGGTGACCAGATGCATTCATTGATGCAATGTGGGGAGCAAATCTTAAATCTTTTCAACCCAGAGGGTCGCAGTTTTGA
TAGCTTGTTGGATAAAGTGAAAGAGATTGTAGAAAGTAATGAAAATAGGAGACTTCCCAAGCTTCCAAAGGGAACTCGAG
ATTTCGCTAAAGAACAAATGGCAGTCCGAGAAAAAGCCTTTTCAATCATACAAAACGTTTTCAAGAGGCATGGTGCAACT
GCACTTGATACTCCTGTTTTTGAATTGAGAGAGACCCTTATGGGAAAGTACGGAGAAGACTCGAAATTGGTTTATGATAT
TGCTGATCAGGGTGGAGAGCTTTGCTCTTTACGATATGATCTAACTGTTCCATTTGCACGGTATGTGGCTATGAATGGAA
TCACATCATTCAAAAGATACCAAATAGCAAAGGTGTACAGAAGGGATAATCCATCTAAAGGGAGATACAGAGAGTTTTAT
CAGTGTGATTTTGATATCGCTGGTTTGTTCGAACCAATGGGACCCGATTTTGAAATTGTCAAGATATTAACTGAACTCCT
CGATGAGTTAGAAATAGGAGATTATGAGGTGAAACTGAATCACCGCAAGTTGCTTGATGGAATGCTGGAGATATGTGGAG
TACCACCTGAGAAATTCAGAACCATCTGTTCGAGTATCGACAAGCTAGACAAGCAATCGTTTGAGCAAGTGAAGAAAGAA
ATGGTGGAGGAGAAGGGCTTGTCTTCAGAGATTGCAGACAGAATTGGCAACTTCGTTAAGGAGAAGGGAGCTCCTTTGGA
GCTGTTGTCTAAACTGAGACAAGAAGGGAGTGAGTTCTTAGATAACCAGTCATCAAGAGAAGCTCTTGATGAGTTGAGTA
TCATGTTTGAAGCTCTTAAAAGATCAAAGTGCAGTGAGAGAATAGTCTTTGATCTAAGTCTAGCTAGAGGTCTTGATTAC
TACACCGGCGTCATCTTTGAAGCTGTTTGTATAGGAGCAGAGGTGGGATCAATTGGTGCTGGTGGGCGATATGATAACCT
TATAGGAATGTTTGGAACAAAGCAAGTCCCTGCGGTTGGGATGAGCCTGGGAATCGAGAGAGTGTTTAACATAATGGAAG
AACTTAACGAGAAACAGAAACAAGTGATTCGACCAACGGAGACACAGGTGTTGGTTAGTATAATGGTGGATAATAAACTA
GCGGAAGCAGCAGAACTGGTAAGTCAGTTATGGGGTGCTAAGATCAACGCAGAGTATCTAGTGAGCAAGAGGAAAGAAAA
GCATTTCAATCGTGCAAAGGAATCAGGGATTCCTTGGATGGTGATGGTAGGCGAAAAAGAACTCAGTGGAAGTTTTGTGA
CATTGAAGAAGCTCGAGAAGGGAAGTGAAGAGAAAGAAGATCAAACATGTACTAGAGATCGTTTCGTGGAAGAATTGAAG
AAACTACTCTGA