Details for Arabidopsis Locus AT3G02730

Position : Chr3 ( 5`- 588408 .. 589685 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02730

Protein [Map View]
MPLSLRLSPSPTALSPTTGGFGPSRKQCRIPYSGVPTTKIGFCSLDSRKRGDSSVVRCSLETVNVSVGQVTEVDKDTFWP
IVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGA
KYDDLVAAIETARSAASG*

DNA
ATGCCTCTTTCTCTCCGTCTTTCTCCTTCGCCGACGGCTTTATCTCCGACTACCGGAGGATTTGGTCCATCGAGGAAACA
GTGCCGGATTCCTTACTCCGGCGTCCCGACGACGAAGATTGGTTTCTGTTCTTTGGATTCTAGGAAAAGAGGAGATTCCT
CTGTTGTTAGGTGTAGCTTAGAAACCGTTAATGTCAGTGTTGGTCAGGTGACGGAGGTCGATAAGGACACGTTCTGGCCC
ATCGTTAAAGCCGCCGGTGAAAAGCTTGTCGTACTTGACATGTACACTCAATGGTGTGGTCCATGTAAAGTGATTGCCCC
TAAATACAAAGCTTTATCAGAGAAGTACGACGACGTTGTGTTTCTAAAGCTTGACTGCAATCCAGATAACCGGCCATTGG
CAAAAGAGCTAGGAATAAGAGTGGTTCCAACTTTCAAGATTTTGAAGGATAACAAGGTTGTCAAGGAAGTGACCGGTGCA
AAATACGATGATCTGGTTGCAGCGATTGAAACAGCGAGGTCTGCTGCTTCCGGATGA