Details for Arabidopsis Locus AT3G02700

Position : Chr3 ( 5`- 581541 .. 582949 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02700

Protein [Map View]
MGFLSNKISRDDVKPGDHIYSWRQAYIYAHHGIYVGNGQVNHFTRGDGQETGTGTFLDNIIVSSSHNHGDNPCPDCGDRS
NLGGVISSCLECFLAGGDLYVFEYSVSPAIFLAKPRGGVCTIASSDPPEEVIYRANFLLQNGFGVYNVFKNNCEDFAIYC
KTGLLVANTDVGRSGQAASIVAAASVLLSSPLRFVAGFGGLAVAGYGMYCTSRLVSDIGMRWDVSKVPVERLVADVACMS
DMEAKPEDEKTT*

DNA
ATGGGATTCCTTTCCAATAAAATCTCCAGAGACGATGTGAAACCAGGCGATCACATCTATTCATGGCGTCAAGCCTACAT
TTACGCTCATCACGGAATCTATGTAGGTAATGGACAAGTCAACCATTTTACTCGTGGTGATGGTCAAGAGACTGGAACTG
GGACTTTCTTGGACAACATCATTGTTAGTTCATCTCATAATCATGGAGACAACCCATGTCCTGATTGTGGAGATCGATCC
AATCTTGGCGGTGTTATATCTTCCTGCCTTGAATGTTTCCTTGCCGGAGGTGATCTCTATGTCTTTGAGTACAGTGTTTC
CCCTGCTATCTTTCTTGCCAAACCTCGAGGCGGCGTATGCACTATAGCATCTTCAGATCCTCCAGAAGAAGTCATCTATC
GAGCAAATTTTCTCTTGCAAAATGGTTTTGGTGTGTACAATGTCTTCAAGAACAACTGTGAAGATTTTGCCATCTATTGC
AAAACGGGTTTGCTAGTGGCAAACACCGACGTGGGAAGGAGTGGTCAAGCTGCTTCAATTGTTGCAGCTGCCAGTGTTCT
TCTTTCTTCACCACTCAGGTTTGTAGCAGGTTTTGGTGGTTTGGCTGTGGCTGGCTATGGCATGTACTGCACCAGTCGCT
TAGTTTCAGATATAGGCATGCGATGGGATGTGAGCAAGGTGCCTGTTGAGAGACTAGTTGCTGATGTGGCTTGTATGTCG
GACATGGAAGCTAAACCAGAAGATGAGAAGACTACTTAA