Details for Arabidopsis Locus AT3G02690

Position : Chr3 ( 5`- 579586 .. 581611 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02690

Protein [Map View]
MEWPWSAIAASSSSSSSCFFASPNSCLSITRRTNLSCVNTSVKSLRHSRFDSKHNLVKRRINGDSVVRRSTTSNNSTEET
ESSSSSSSVDCVGMGSDVECVNNGEDEENRSSGILSGGEGTFLEWTVLISPFFFWGTAMVAMKEVLPITGPFFVAAFRLI
PAGLLLVAFAVYKGRPLPEGINAWFSIALFALVDATCFQGFLAQGLQRTSAGLGSVIIDSQPLTVAVLASFLFGESIGIV
RAGGLLLGVAGLLLLEVPSVTSDGNNFSLWGSGEWWMLLAAQSMAIGTVMVRWVSKYSDPIMATGWHMVIGGLPLLAISV
INHDPVFNGSLQDLSTNDVIALLYTSIFGSAVSYGVYFYSATKGSLTKLSSLTFLTPMFASIFGYLYLNETFSSLQLVGA
AVTLVAIYLVNFPEGND*

DNA
ATGGAGTGGCCATGGTCGGCCATCGCTGCTTCTTCTTCCTCTTCTTCTAGTTGCTTCTTTGCTTCTCCTAACTCTTGCTT
GTCTATTACTAGACGAACGAATTTGAGCTGTGTTAACACTTCGGTTAAATCCTTGCGCCACAGCAGATTCGACTCGAAGC
ATAATCTCGTTAAACGTCGAATCAATGGAGATTCCGTTGTTCGGAGAAGCACCACAAGCAATAATAGCACTGAGGAGACA
GAATCATCGTCGTCTTCTTCGTCTGTAGATTGCGTTGGAATGGGATCAGACGTGGAATGCGTCAATAACGGGGAAGATGA
GGAGAATCGGAGCTCTGGAATCTTGAGCGGCGGTGAAGGAACGTTTCTTGAATGGACGGTTCTGATTTCACCCTTCTTTT
TCTGGGGAACGGCGATGGTGGCGATGAAGGAAGTGTTGCCCATTACTGGTCCTTTCTTCGTGGCCGCGTTTCGGTTAATT
CCGGCTGGTTTGTTGCTTGTCGCCTTTGCAGTTTACAAAGGCAGACCTTTGCCTGAAGGAATCAATGCTTGGTTCTCTAT
CGCTCTCTTTGCTCTTGTGGACGCCACTTGTTTCCAGGGATTTCTTGCTCAAGGGTTACAGAGAACTTCTGCTGGTTTAG
GAAGTGTCATAATTGATTCTCAGCCACTGACTGTAGCTGTGTTAGCATCTTTCTTGTTTGGTGAGTCAATTGGAATAGTG
AGAGCTGGAGGTTTGCTTCTTGGTGTTGCTGGACTTTTGCTTCTTGAGGTTCCATCAGTAACTTCAGATGGTAATAATTT
TTCCTTGTGGGGAAGTGGAGAATGGTGGATGCTTCTTGCAGCTCAGAGCATGGCTATTGGCACTGTCATGGTTCGATGGG
TCTCAAAATACTCAGATCCAATTATGGCAACCGGTTGGCATATGGTTATCGGTGGCCTTCCTCTTTTGGCGATTTCTGTT
ATAAATCATGACCCGGTTTTTAATGGTAGTCTTCAAGATCTATCCACAAATGATGTTATAGCACTTCTCTACACATCCAT
TTTTGGCAGCGCAGTTAGCTACGGTGTTTACTTCTATAGCGCTACTAAAGGAAGCCTAACTAAACTCAGCTCACTCACCT
TCTTGACACCAATGTTTGCATCAATCTTTGGGTATCTGTACCTCAATGAGACTTTCTCCTCATTGCAACTGGTCGGAGCA
GCAGTGACTTTGGTCGCTATATACTTGGTGAACTTTCCCGAAGGCAACGACTGA