Details for Arabidopsis Locus AT3G02680

Position : Chr3 ( 5`- 576378 .. 579559 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02680

Protein [Map View]
MVWGLFPVDPLSGEDKYYIFSKGIYKVGRKGCDIIINKDKGVSRIHAELTFDATTVSTSRRNKSSSDTSSFVIRVKDCSK
YGTFVKTDLGTKDKVHELSNKEKILQDGDVIAFGTGSAIYRLSLIPLVFYLCPSSETFKVDQPVQDAVSSIGARISPTLS
EECTHVLLEPRMQVNEALINAILAKKTIILTNWVMLLAEKSICSEIPGYSQYRPSVMVEEALVDVLELNVREKCLEGFTF
VLEPTDTYRFGCSFPSLLEVCGAETVTIEDISSMSQDSQFGEINRMICVIPKSAGDKFGRFKHLSLLSRVNEMDLVCAVF
SGNLPSTSLIPPSVVISSSCSTDETVVADSEAEEEETTSSVHMIDATEKAETPEKPAAIVIEDSPVTILEETSNLNEFKS
VNLLADTESRGHMDEKNSSDSVTIRRDRNDEAETGKSEIIYTQDLIVRDLRSTRKVQSTGGEGVVDFKRFRKGNVTCGNS
FSSLIPFAKDPYKEYDSWDVTDFMKEEKKRKQMEAIAEDLFKTEKARKRGTAGSIRGFLSGS*

DNA
ATGGTTTGGGGTCTCTTTCCCGTTGATCCTCTTTCAGGTGAAGATAAATACTATATCTTTTCAAAGGGTATTTACAAGGT
TGGTCGAAAAGGATGTGATATAATTATCAATAAGGATAAGGGGGTATCTAGGATCCACGCTGAGTTAACTTTTGATGCAA
CAACTGTTTCAACCTCTCGGAGGAACAAGTCTTCTTCAGATACATCATCCTTTGTTATCCGTGTCAAAGATTGTTCAAAG
TATGGGACTTTTGTCAAAACTGACCTGGGGACAAAAGATAAAGTTCATGAGCTATCTAATAAGGAGAAAATTCTCCAAGA
TGGAGATGTTATCGCGTTTGGTACAGGTTCTGCAATTTACAGGTTGTCCTTAATTCCGCTTGTTTTTTACTTGTGCCCTT
CCTCTGAGACCTTTAAGGTGGATCAGCCTGTACAAGATGCAGTTTCATCAATTGGTGCTCGTATTTCTCCTACATTGAGT
GAGGAGTGCACTCATGTGCTTCTTGAGCCACGTATGCAAGTGAATGAAGCTCTGATCAATGCAATTTTAGCCAAAAAAAC
AATCATTTTGACAAACTGGGTTATGCTTCTCGCAGAGAAAAGTATCTGCAGCGAAATTCCTGGATACAGCCAGTACAGAC
CATCAGTGATGGTTGAAGAAGCTTTGGTGGATGTACTAGAATTAAACGTCCGTGAAAAATGTCTAGAAGGATTTACCTTT
GTCTTGGAACCAACAGACACGTATAGATTTGGTTGCAGCTTCCCATCTTTACTTGAAGTATGTGGTGCAGAGACCGTTAC
CATAGAAGACATTAGCTCCATGAGTCAGGATTCTCAGTTTGGAGAGATTAATCGCATGATATGTGTCATCCCAAAAAGTG
CAGGAGACAAATTTGGCCGTTTCAAGCATCTCAGTTTGTTATCTAGAGTGAACGAGATGGATTTAGTATGCGCCGTCTTT
TCCGGAAATCTACCTTCGACTTCACTGATACCACCATCCGTTGTAATTTCATCCTCGTGCTCTACAGATGAGACAGTGGT
AGCGGATTCTGAAGCCGAAGAGGAAGAAACAACATCGTCTGTTCATATGATTGATGCTACTGAAAAGGCAGAAACGCCAG
AGAAGCCTGCTGCTATTGTAATAGAGGATAGCCCTGTTACTATATTGGAAGAAACTTCGAATTTGAACGAGTTTAAAAGC
GTGAACTTATTAGCGGATACAGAAAGTAGAGGCCACATGGATGAAAAGAACTCAAGTGATAGTGTGACAATCCGAAGGGA
TCGGAACGATGAGGCTGAAACTGGGAAATCGGAGATTATATACACTCAAGATCTTATTGTTAGGGACTTGCGATCGACTA
GAAAAGTTCAATCGACAGGAGGGGAAGGAGTTGTGGACTTCAAGCGATTCAGAAAGGGAAATGTTACATGCGGAAACAGC
TTCAGTAGCCTAATACCTTTTGCGAAGGATCCATACAAAGAATACGATAGCTGGGACGTGACAGATTTTATGAAAGAAGA
GAAGAAAAGGAAGCAGATGGAAGCCATTGCAGAGGACTTGTTTAAAACTGAAAAGGCTAGAAAGCGTGGAACGGCTGGTT
CCATTCGCGGGTTTCTCTCTGGAAGTTGA