Details for Arabidopsis Locus AT3G02660

Position : Chr3 ( 5`- 570134 .. 572345 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02660

Protein [Map View]
MAYATGITFASRSILPICSRTFLSPLRVASLLVFPEKSSATFFRRVQVPHLFSTSTTTLFSSVKCSIHSTSSPETENQAV
FRPNVVDILEERGLLESITSENLRSACSDPKVAPLRVYCGFDPTAESLHLGNLLGIIVLSWFQRCGHQAVGLIGGATGRV
GDPSGKSLERPELDADTLEKNIAGITKIIIKILGSNPSPGGSYVIFNNYDWWKDMTMLDFLNKVGRFARVGTMMAKESVK
KRLESEQGMSYTEFTYQLLQAYDFLHLFKNEGINVQIGGSDQWGNITAGTDLIRKILQAEEAAYGLTFPLLLKNDGTKFG
KSEDGAIWLSPSMLSPYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKILEDQMSKPGYVPNTAQIKLAEEVTRFVHGEEG
LKEAIKATEALRPGAETKLDWNLIERIAEDIPSCSLPIDRVSGLSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDD
ENKRVDEEDIVEGRGLVLSAGKKNKVVVRIS*

DNA
ATGGCATATGCAACAGGAATAACGTTTGCCTCAAGGAGTATTTTGCCTATTTGTTCCAGAACCTTCTTATCTCCCTTGCG
TGTCGCTTCTTTACTCGTCTTTCCTGAGAAATCATCTGCAACTTTCTTCAGAAGGGTCCAAGTTCCTCACCTTTTTTCCA
CTTCTACTACTACTCTGTTCTCTTCTGTTAAGTGTTCAATTCATTCTACTTCATCTCCTGAGACAGAGAATCAAGCTGTT
TTTCGCCCTAATGTAGTCGATATACTTGAAGAAAGAGGTCTCCTCGAGTCAATCACAAGCGAGAATCTCAGGTCAGCTTG
TTCTGATCCTAAAGTAGCTCCTTTAAGGGTCTACTGTGGGTTTGATCCAACGGCTGAGAGTTTACACTTGGGTAATCTAC
TTGGTATCATTGTGCTTTCTTGGTTCCAAAGATGTGGACATCAAGCCGTTGGTTTAATTGGTGGTGCCACGGGACGGGTT
GGTGACCCATCTGGTAAAAGCTTAGAAAGACCTGAGCTTGACGCTGATACACTGGAGAAAAATATTGCGGGGATTACAAA
AATCATTATCAAGATTCTAGGTAGTAATCCGAGTCCCGGTGGCTCTTACGTGATTTTTAATAACTATGACTGGTGGAAAG
ATATGACAATGCTCGACTTTCTGAACAAAGTCGGTAGGTTTGCTAGGGTTGGTACTATGATGGCAAAGGAGAGTGTGAAG
AAGAGATTAGAATCAGAGCAAGGTATGAGCTACACCGAGTTCACTTATCAGTTGTTGCAAGCCTATGATTTTCTTCACCT
GTTCAAGAACGAAGGGATCAATGTTCAGATAGGTGGCAGTGATCAATGGGGGAATATAACAGCTGGAACTGATTTGATCA
GGAAGATTCTCCAAGCAGAAGAAGCGGCTTACGGGCTAACATTTCCTCTCCTACTGAAAAACGATGGAACGAAATTCGGG
AAATCAGAAGATGGAGCAATCTGGCTATCTCCTTCGATGTTATCGCCTTATAAGTTCTATCAGTACTTCTTTTCAGTTCC
AGACGTTGATGTGATACGCTTCTTAAAGACATTAACATTTCTGAGCTTGGATGAGATAAAGATCTTGGAAGATCAAATGA
GCAAACCCGGCTATGTTCCCAACACCGCACAAATCAAACTCGCTGAAGAAGTAACCAGATTCGTACATGGCGAAGAGGGT
TTGAAAGAAGCCATTAAAGCAACAGAAGCTTTAAGACCAGGTGCTGAGACAAAGCTTGATTGGAACTTGATTGAGAGAAT
AGCAGAGGATATACCTTCTTGCTCACTGCCTATTGATCGAGTGTCGGGTTTATCGATTGTGGATCTATCGGTTTCTGCAG
GTTTGTTTGAGAGCAAATCTGCTGCGAGGAGAATGTTGAAGCAAGGTGGGTTTTATATGAACAATGAGAGAGTTGATGAT
GAGAATAAGAGAGTGGACGAAGAGGATATTGTTGAAGGGAGAGGTCTTGTTCTATCAGCAGGCAAGAAGAATAAAGTGGT
CGTTAGAATTTCCTGA