Details for Arabidopsis Locus AT3G02600

Position : Chr3 ( 5`- 551100 .. 554671 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02600

Protein [Map View]
MARFSFPCFPNFGGFNQAVTNRGPEISETADNWVSPSDIPLIEPNSKEHRMREAQLGGHTLRSHGMTVARTHMHDWIILV
LLVILECVLLIIHPFYRFVGKDMMTDLSYPLKSNTVPIWSVPVYAMLLPLVIFIFIYFRRRDVYDLHHAVLGLLYSVLVT
AVLTDAIKNAVGRPRPDFFWRCFPDGKALYDSLGDVICHGDKSVIREGHKSFPSGHTSWSFSGLGFLSLYLSGKIQAFDG
KGHVAKLCIVILPLLFAALVGISRVDDYWHHWQDVFAGGLLGLAISTICYLQFFPPPYHTEGWGPYAYFQVLEAARVQGA
ANGAVQQPPPQVNNGEEEDGGFMGLHLVDNPTMRREEDVETGRG*

DNA
ATGGCTCGCTTCAGTTTTCCTTGTTTTCCAAATTTTGGGGGTTTTAATCAGGCTGTGACAAATCGGGGGCCTGAGATTTC
AGAAACTGCTGATAATTGGGTCTCACCATCTGACATTCCACTCATAGAACCTAATAGTAAAGAGCACAGGATGAGAGAGG
CACAGCTAGGCGGTCACACTCTGAGGTCCCATGGAATGACTGTTGCAAGGACTCACATGCATGATTGGATCATTCTCGTG
TTACTTGTTATTCTCGAGTGTGTACTCCTTATAATCCACCCATTTTATCGCTTTGTTGGTAAAGATATGATGACTGATCT
AAGTTACCCGTTAAAGAGTAACACCGTACCAATTTGGTCTGTCCCGGTATATGCGATGCTGTTACCTTTGGTAATCTTCA
TCTTTATCTACTTCCGTCGAAGAGATGTTTATGATCTTCATCACGCGGTGCTAGGTCTCTTATACTCTGTTCTGGTGACA
GCAGTACTTACCGATGCAATAAAGAATGCAGTTGGTCGACCACGTCCTGACTTCTTCTGGCGTTGTTTTCCAGATGGCAA
AGCTCTTTATGATAGCCTTGGAGATGTTATATGCCATGGTGATAAAAGCGTCATAAGGGAAGGTCACAAAAGCTTTCCAA
GTGGACACACGTCATGGTCTTTTTCGGGTCTCGGATTTCTTTCGCTTTACTTATCGGGAAAGATTCAAGCATTTGACGGT
AAAGGCCACGTTGCAAAGCTATGCATAGTCATACTCCCTTTGCTATTTGCAGCTCTTGTCGGCATTTCCCGTGTTGATGA
CTATTGGCATCATTGGCAAGACGTCTTTGCAGGAGGCTTGCTAGGTCTTGCGATCTCTACAATCTGTTATCTTCAATTTT
TCCCGCCACCATATCACACCGAAGGTTGGGGACCATATGCTTACTTCCAAGTGTTGGAGGCTGCGAGAGTGCAAGGAGCA
GCGAATGGAGCAGTGCAGCAGCCGCCGCCCCAAGTTAACAACGGTGAAGAAGAAGACGGTGGGTTTATGGGTTTACATTT
GGTGGATAATCCGACTATGAGGAGAGAAGAGGATGTAGAAACTGGTAGAGGCTGA