Details for Arabidopsis Locus AT3G02555

Position : Chr3 ( 5`- 539639 .. 541503 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02555

Protein [Map View]
MNHCSLQQNAFLSREESRGFVPIYSHPVDSVVCPKPRRANNVIRPFRLHFSLSGADDVCDSKAGEDLLDIFRRKESVSSR
SPPFFLGSPPSRAANPLAQDARFGDEKLNTVSPSLSPLLPSASRVKSGCGRMKFGVKPATVRVEGFDCLNRDRPNSSIPA
MA*

DNA
ATGAATCATTGTAGCCTTCAGCAGAATGCATTCTTGTCTCGTGAAGAATCGAGAGGATTTGTTCCTATCTATTCTCATCC
AGTGGACTCTGTTGTTTGCCCTAAGCCCCGTCGTGCAAACAACGTTATTCGTCCCTTTAGATTACATTTTAGTCTTTCAG
GAGCTGATGATGTATGTGATTCTAAAGCCGGGGAAGATCTTTTGGACATATTTCGTAGAAAGGAATCAGTATCATCTAGA
TCACCCCCATTTTTCCTTGGGTCTCCCCCTAGCCGAGCAGCAAACCCGTTAGCTCAAGATGCACGCTTTGGAGATGAGAA
ACTCAACACTGTCTCACCCTCACTCTCCCCTCTTCTCCCATCTGCATCTCGTGTTAAAAGTGGTTGTGGTAGAATGAAGT
TTGGGGTGAAACCAGCAACTGTTAGAGTAGAAGGGTTTGATTGCTTGAACAGGGACCGCCCAAACTCAAGTATCCCTGCC
ATGGCCTAG