Details for Arabidopsis Locus AT3G02550

Position : Chr3 ( 5`- 536505 .. 537998 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02550

Protein [Map View]
MRMSCNGCRVLRKGCSEDCSIRPCLAWIKSPEAQANATVFLAKFYGRAGLMNLINAGPNHLRPGIFRSLLHEACGRIVNP
IYGSVGLLWSGNWQLCQDAVEAVMKGEPVKEIATDAATIGQGPPLKIYDIRHISKDDNSAAAATGSTDLKLAKTRRAKRV
STVAIQAESEGKSDEASHDSSLSHQSEIVAAHEGESKESESNVSEVLAFSPPAVKGSGEIKLDLTLRLEPVSRAYHVVPV
KKRRIGVFGTCQKESTCKTELML*

DNA
ATGCGGATGAGCTGTAATGGATGCAGAGTTCTTCGGAAAGGGTGTAGTGAGGATTGTAGTATAAGGCCGTGTTTGGCTTG
GATCAAATCGCCTGAAGCGCAAGCTAACGCAACTGTCTTTCTCGCCAAGTTCTATGGCCGTGCTGGACTCATGAACCTCA
TCAACGCCGGTCCCAATCACCTTCGTCCTGGGATTTTCCGATCGTTGTTGCACGAAGCTTGTGGGAGGATTGTGAATCCG
ATCTATGGTTCGGTGGGTTTGTTGTGGTCGGGGAATTGGCAGCTTTGTCAAGACGCCGTGGAGGCTGTGATGAAAGGAGA
ACCGGTCAAAGAGATCGCCACAGACGCTGCGACGATCGGCCAAGGTCCGCCTCTTAAGATCTACGACATCCGACATATCT
CCAAGGATGATAACTCTGCCGCCGCGGCTACTGGCTCAACCGATTTGAAACTTGCGAAAACTCGCCGTGCTAAGCGGGTC
TCCACCGTCGCGATACAGGCGGAATCGGAGGGAAAGTCTGACGAGGCTAGTCACGATTCGTCGTTGAGTCATCAGTCTGA
AATAGTGGCTGCTCATGAAGGAGAGAGCAAGGAATCCGAGAGCAATGTCTCTGAGGTTTTGGCATTCTCGCCTCCGGCTG
TGAAGGGCTCCGGCGAGATAAAGCTTGACCTAACTTTAAGGCTCGAACCGGTGTCACGTGCGTATCATGTGGTACCTGTT
AAGAAGAGAAGGATCGGCGTGTTTGGCACGTGTCAGAAGGAGAGCACGTGTAAGACTGAGCTTATGCTCTAA