Details for Arabidopsis Locus AT3G02540

Position : Chr3 ( 5`- 532808 .. 536342 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02540

Protein [Map View]
MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIEENKVAENSFIVIMMNKSKPA
SAAASSASAGTSQAKSIPPSTSQPSISPQTPASVSAPVAPAPTRPPPPAPTPTPAPVAATETVTTPIPEPVPATISSSTP
APDSAPVGSQGDVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTGIPEQAEVPPVAR
PPASAGQPANPPAQTQQPAAAPASGPNANPLDLFPQGLPNVGGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQEL
GKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACN
KNEELAANYLLDHMHEFEE*

DNA
ATGAAGATATTTGTGAAAACTCTCAAGGGGACTCACTTCGAGATCGAAGTAAAACCCGAGGATTCGGTTGTTGATGTGAA
GAAGAACATAGAGAGTGTGCAGGGCGCAGATGTGTATCCTGCTGCAAAACAGATGCTTATTCACCAAGGTAAAGTGCTTA
AAGATGAGACAACTATTGAGGAAAACAAAGTTGCTGAGAACAGTTTTATTGTCATTATGATGAACAAGAGTAAACCTGCT
TCAGCTGCAGCATCTAGTGCATCTGCTGGCACATCGCAGGCCAAGTCGATACCTCCCTCAACATCACAGCCTTCAATTTC
CCCTCAGACTCCAGCTTCTGTATCAGCACCAGTGGCACCTGCACCAACACGTCCACCACCACCTGCACCGACACCGACAC
CTGCACCTGTAGCTGCAACTGAAACTGTGACTACCCCTATACCTGAACCTGTACCTGCTACTATATCATCAAGCACTCCT
GCACCAGACTCAGCTCCTGTGGGAAGTCAAGGTGATGTTTACGGACAAGCAGCATCAAATCTAGCCGCTGGAAGTAATTT
AGAGAGTACCATTCAGCAGATTCTTGACATGGGTGGAGGAACCTGGGATCGTGAGACTGTTGTCCTTGCACTTCGTGCTG
CATTTAACAACCCTGAAAGAGCTGTGGAATATCTTTATACTGGGATCCCTGAGCAAGCTGAAGTTCCACCAGTTGCCCGT
CCTCCAGCTAGTGCCGGACAGCCTGCAAATCCTCCAGCACAGACTCAACAACCTGCAGCAGCACCCGCAAGTGGTCCTAA
TGCAAATCCGTTAGATCTCTTCCCACAGGGCTTGCCAAATGTTGGAGGAAATCCTGGTGCTGGAACACTTGACTTCTTGC
GCAACAGCCAACAGTTCCAAGCTCTGCGAGCAATGGTGCAAGCAAACCCTCAAGTTCTGCAGCCCATGCTTCAGGAACTG
GGAAAACAGAACCCAAACTTGATGCGGTTGATTCAAGACCACCAAGCTGACTTCTTACGCTTAATCAATGAACCCGTTGA
AGGAGGGGGAGAAAGTGGCAACCTCCTTGGCCAAATGGCGGCGGGAATGCCACAGCCACAGGCGATTCAAGTCACACATG
AGGAACGTGAAGCCATTGAACGGCTTGAAGCGATGGGATTTGAGAGAGCATTGGTGTTGGAAGTGTTCTTTGCGTGCAAC
AAGAATGAAGAGTTGGCTGCAAACTATCTTCTAGATCACATGCATGAATTCGAGGAATAA