Details for Arabidopsis Locus AT3G02530

Position : Chr3 ( 5`- 528574 .. 532582 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02530

Protein [Map View]
MSVRVLNPNAEVLNKSAALHMTINAAKGLQDVLKSNLGPKGTIKMLVGGSGDIKLTKDGNTLLKEMQIQNPTAIMIARTA
VAQDDISGDGTTSTVIFIGELMKQSERCIDEGMHPRVLVDGFEIAKRATLQFLDTFKTPVVMGDEPDKEILKMVARTTLR
TKLYEGLADQLTDIVVNSVLCIRKPQEPIDLFMVEIMHMRHKFDVDTRLVEGLVLDHGSRHPDMKRRAENCHILTCNVSL
EYEKSEINAGFFYSNAEQREAMVTAERRSVDERVQKIIELKNKVCAGNDNSFVILNQKGIDPPSLDLLAREGIIALRRAK
RRNMERLVLACGGEAVNSVDDLTPDCLGWAGLVYEHVLGEEKYTFVEQVKNPHSCTILIKGPNDHTIAQIKDAVRDGLRS
VKNTLEDECVVLGAGAFEVAARQHLINEVKKTVQGRAQLGVEAFANALLVVPKTLAENAGLDTQDVIISLTSEHDKGNIV
GLDLQDGEPVDPQLAGIFDNYSVKRQLINSGPVIASQLLLVDEVIRAGRNMRKPT*

DNA
ATGTCTGTGCGTGTACTGAATCCTAATGCTGAGGTGCTCAACAAATCGGCCGCGCTTCATATGACCATCAACGCCGCTAA
GGGTTTACAAGATGTACTCAAGTCGAATCTCGGTCCTAAGGGAACTATCAAGATGCTTGTTGGTGGTTCCGGAGATATCA
AGCTTACCAAGGATGGCAACACGCTTTTGAAGGAAATGCAAATTCAAAATCCAACAGCCATCATGATTGCCAGGACAGCT
GTTGCTCAGGATGACATAAGTGGTGATGGTACTACTTCTACTGTCATCTTCATTGGTGAGCTTATGAAACAGTCGGAGCG
TTGCATCGATGAAGGAATGCATCCACGTGTCTTAGTTGATGGTTTCGAGATTGCAAAAAGAGCCACTCTCCAGTTTCTCG
ACACTTTCAAGACACCTGTGGTTATGGGTGATGAGCCTGATAAAGAGATTCTGAAAATGGTTGCCAGGACAACGCTAAGA
ACTAAGCTGTATGAAGGCTTAGCTGATCAACTGACTGATATTGTTGTTAATTCGGTTCTCTGCATTCGGAAGCCTCAGGA
ACCTATTGATCTGTTTATGGTTGAGATTATGCACATGCGCCATAAATTTGATGTTGACACACGATTGGTTGAGGGGCTTG
TTCTTGATCATGGTTCGAGACACCCTGACATGAAGCGACGTGCGGAGAATTGTCACATCCTGACTTGCAATGTGTCATTA
GAGTACGAGAAGAGTGAAATTAATGCAGGATTCTTCTACTCGAATGCGGAGCAGAGGGAAGCCATGGTTACTGCTGAGCG
ACGTTCCGTTGATGAAAGAGTTCAGAAAATTATTGAGCTGAAGAACAAGGTTTGTGCTGGTAATGATAACAGCTTTGTTA
TCCTAAATCAAAAGGGTATTGATCCCCCGTCATTGGATCTTCTTGCTAGAGAAGGGATAATCGCCCTTAGAAGGGCAAAG
AGGAGGAACATGGAACGTTTGGTTTTGGCATGTGGTGGAGAAGCTGTGAACTCTGTCGATGACTTGACCCCTGATTGTCT
TGGTTGGGCTGGACTTGTATATGAGCACGTTCTTGGAGAGGAGAAGTACACATTTGTTGAGCAAGTGAAGAATCCTCATT
CATGTACTATCCTCATAAAAGGGCCTAATGACCACACTATTGCTCAAATTAAGGACGCTGTCCGTGATGGTTTAAGATCA
GTTAAGAATACCCTAGAAGATGAGTGTGTCGTATTAGGAGCTGGAGCTTTTGAAGTTGCAGCAAGACAACACTTAATCAA
TGAAGTCAAGAAAACCGTTCAAGGGCGCGCTCAACTCGGTGTTGAAGCTTTTGCTAATGCCCTTCTCGTAGTGCCTAAGA
CGCTTGCTGAAAATGCTGGGCTTGACACTCAAGACGTTATCATTTCTCTAACGAGTGAGCATGACAAAGGAAACATCGTG
GGACTAGACCTACAGGATGGAGAACCCGTCGACCCTCAGCTTGCCGGCATTTTCGACAATTACTCGGTGAAACGCCAACT
TATCAATTCAGGGCCGGTGATTGCTTCGCAGTTGCTATTAGTGGATGAAGTGATTCGTGCAGGAAGAAATATGAGGAAGC
CTACTTAA