Details for Arabidopsis Locus AT3G02493

Position : Chr3 ( 5`- 515944 .. 516358 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02493

Protein [Map View]
MESIMSLKRKEKKSQSRRLGKYLKEQKGRIYIIRRCVMMLLCSHD*

DNA
ATGGAAAGCATCATGAGCTTGAAGAGAAAGGAGAAGAAATCCCAAAGTAGAAGACTCGGGAAATATCTGAAAGAACAAAA
GGGGAGGATCTACATCATTAGAAGATGTGTGATGATGCTCCTTTGTTCGCATGATTAA