Details for Arabidopsis Locus AT3G02480

Position : Chr3 ( 5`- 512312 .. 513027 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02480

Protein [Map View]
MDNKQNASYQAGQATGQTKEKAGGMMDKAKDAAASAQDSLQQTGQQMKEKAQGAADVVKDKTGMNKSH*

DNA
ATGGACAACAAGCAAAACGCGAGCTACCAAGCCGGTCAAGCCACTGGCCAGACTAAGGAGAAGGCCGGTGGAATGATGGA
CAAGGCCAAGGATGCTGCTGCTTCAGCTCAAGACTCCTTGCAACAGACTGGACAACAAATGAAGGAGAAGGCGCAAGGAG
CTGCTGATGTCGTCAAGGACAAGACCGGCATGAACAAAAGCCACTAA