Details for Arabidopsis Locus AT3G02460

Position : Chr3 ( 5`- 505434 .. 508428 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02460

Protein [Map View]
MSRKRTENGSESGPATSHVPVDRFGFLKQEHANSPERFSKSKTTSSTDHDREERKVRKWRKMIGVGGSDWKHYVRRKPNV
VRRRIRKGIPDCLRGLVWQLISGSRDLLLMNPGVYEQLVIYETSASELDIIRDISRTFPSHVFFQKRHGPGQRSLYNVLK
AYSVYDRDVGYVQGMGFIAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYHAGLPLVQQYLFQLESLVKELIPKLGEHF
TQEMINPSMYASQWFITVFSYSFPFPLALRIWDVFLSEGVKIVFKVGLALLKYCQDELVKLPFEKLIHALKTFPEDAMNP
DTLLPLAYSIKVSKRLEELTLEYQKTNAKPVQP*

DNA
ATGAGTAGAAAAAGAACGGAAAATGGCAGTGAATCAGGACCAGCCACTTCTCATGTTCCTGTGGATAGATTCGGGTTTCT
CAAGCAAGAACATGCCAATTCGCCTGAGCGTTTTAGCAAGTCTAAAACTACATCATCCACTGATCATGACAGAGAGGAGA
GAAAGGTGAGAAAATGGAGGAAGATGATTGGGGTTGGAGGGAGTGATTGGAAGCATTATGTTAGGAGAAAACCTAATGTT
GTCAGAAGGCGTATACGAAAAGGGATCCCTGATTGCTTACGAGGTCTTGTTTGGCAGTTAATCTCAGGAAGTCGAGACCT
TTTGCTTATGAATCCTGGTGTTTATGAGCAATTGGTGATTTATGAAACATCTGCATCAGAGCTTGATATCATTCGAGACA
TATCCCGTACTTTCCCATCACATGTTTTCTTTCAGAAGAGACATGGACCTGGGCAAAGATCCTTGTACAATGTCCTTAAG
GCATACTCAGTTTATGACAGAGATGTCGGATATGTTCAGGGGATGGGGTTTATAGCCGGTTTGTTGCTTCTCTATATGAG
CGAAGAAGATGCCTTCTGGTTATTAGTTGCATTACTTAAAGGAGCTGTTCATGCTCCAATGGAAGGACTGTATCATGCAG
GGCTTCCCCTTGTACAGCAATACCTGTTTCAGTTAGAAAGCTTGGTAAAAGAGCTAATTCCGAAGCTCGGAGAACATTTT
ACTCAAGAAATGATTAATCCGAGTATGTATGCAAGTCAATGGTTCATCACCGTCTTCTCATACTCATTTCCTTTCCCTTT
GGCTCTACGGATATGGGATGTGTTTCTCTCCGAGGGTGTTAAAATCGTGTTCAAAGTGGGCTTAGCATTGCTCAAGTATT
GCCAAGATGAGTTGGTAAAGTTACCGTTTGAGAAACTAATACATGCTCTGAAAACTTTCCCGGAAGACGCAATGAATCCG
GATACCTTGCTTCCATTGGCTTACTCTATCAAGGTATCAAAGCGTTTGGAAGAACTGACACTGGAGTATCAGAAGACTAA
TGCCAAACCGGTTCAACCGTAG